Property Summary

NCBI Gene PubMed Count 29
PubMed Score 46.12
PubTator Score 27.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 0.8
Osteoporosis 363 0.0 1.1
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.000 1.4e-02
astrocytic glioma -1.300 7.7e-03
atypical teratoid / rhabdoid tumor -2.800 8.0e-08
Breast cancer -1.200 1.9e-06
chronic rhinosinusitis -1.342 8.5e-03
cystic fibrosis and chronic rhinosinusit... -1.511 1.4e-02
ependymoma -1.800 2.1e-02
glioblastoma -1.700 1.2e-03
group 3 medulloblastoma -2.700 1.9e-02
invasive ductal carcinoma -1.200 8.8e-04
lung adenocarcinoma -1.400 2.6e-06
lung carcinoma 3.100 9.7e-20
medulloblastoma, large-cell -2.200 3.7e-04
non-small cell lung carcinoma -1.300 1.1e-16
oligodendroglioma -1.100 1.1e-02
osteosarcoma -3.326 2.4e-07
ovarian cancer -1.100 8.1e-06
pituitary cancer -1.900 3.9e-03
primitive neuroectodermal tumor -1.600 3.1e-02
subependymal giant cell astrocytoma -4.191 3.8e-04

Gene RIF (15)

AA Sequence

MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKG      1 - 70
IVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFT     71 - 140
PECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPS    141 - 210
LHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT                                     211 - 247
//

Text Mined References (30)

PMID Year Title