Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 5
Funding $400,968.26
PubMed Score 9.65
PubTator Score 4.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26323829 Study found that FGF11 expression can be induced through HIF-1 binding sites in its promoter region suggesting that FGF11 acts as a novel modulator of hypoxia-induced pathological processes such as tumor progression.
25135278 these results concluded that infiltrating CD4(+) T cells could promote PCa metastasis via modulation of FGF11-->miRNA-541-->AR-->MMP9 signaling.

AA Sequence

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKG      1 - 70
IVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFT     71 - 140
AECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPS    141 - 210
LHSVPEASPSSPPAP                                                           211 - 225
//

Text Mined References (10)

PMID Year Title
26323829 2015 Hypoxia-induced fibroblast growth factor 11 stimulates capillary-like endothelial tube formation.
25135278 2015 Infiltrating T cells promote prostate cancer metastasis via modulation of FGF11?miRNA-541?androgen receptor (AR)?MMP9 signaling.
23233218 2012 Roles of intracellular fibroblast growth factors in neural development and functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199049 2004 Functional phylogeny relates LET-756 to fibroblast growth factor 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10662545 2000 Physical map of 17p13 and the genes adjacent to p53.
9070933 1997 Chromosomal mapping of two novel human FGF genes, FGF11 and FGF12.
8790420 1996 Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development.