Property Summary

NCBI Gene PubMed Count 131
Grant Count 128
R01 Count 58
Funding $26,947,549.42
PubMed Score 927.40
PubTator Score 413.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
uncontrolled asthma 2.300 0.008
psoriasis 1.300 0.000
osteosarcoma 1.397 0.000
facioscapulohumeral dystrophy 2.300 0.002

Synonym

Accession Q92911 O43702 Q2M335 Q9NYB6 Na(+)/I(-) cotransporter
Symbols NIS
TDH1

Gene

PANTHER Protein Class (2)

Gene RIF (102)

PMID Text
26831514 Mutating the sites located on the C-terminal domain of the protein has no effect except for the creation of a diacidic motif that decreases the total NIS protein level without affecting its expression at the plasma membrane.
26599396 Therefore, enhancing functional NIS by the increasing level of glycosylation may be suggested as a promising therapeutic strategy for cancer patients who show refractory response to conventional radioiodine treatment.
26285906 Data suggest that SLC5A5, SLC5A8 (sodium-coupled monocarboxylate transporter 1), and SLC26A4 (pendrin), the 3 known iodide transporters, are important in breast tissue metabolism in lactation and in breast neoplasms. [REVIEW]
26282166 miR-146b-3p binds to the 3'-untranslated region of PAX8 and sodium/iodide symporter, leading to impaired protein translation and a subsequent reduction in iodide uptake.
26213306 Real time PCR revealed that both cell lines express mRNA of lactoferrin receptors while flow cytometry and confocal microscopy showed the cells efficiently internalize bLf which upregulates NIS expression.
26160439 Study demonstrates an association of one variant and several haplotypes of the NIS gene with differentiated thyroid cancer.
25960292 concluded that NIS-mediated RAIU could be modulated by miR-146b; accordingly, miR-146b might serve as one of targets to enhance efficacy of radioactive therapy against poorly differential thyroid carcinoma
25955347 Our results confirmed that NIS overexpression enhances the sensitivity of ER-negative breast cancer cells to radioiodide therapy.
25842835 Relatively weak melanoma-specific promoter directs high NIS activity in melanoma cell, however weaker cancer-specific promoters drive high NIS activity only in certain melanoma cell line.
25465605 results indicate that the NIS mutation rate is very low in the Guangxi Zhuang Region, China, and it is necessary to study mutations of other genes that have major effects on thyroid dyshormonogenesis and have not as yet been studied in this population.
More...

AA Sequence

MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVGLSLSASFMSA      1 - 70
VQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEYLEMRFSRAVRLCGTLQYIVA     71 - 140
TMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTAVGGMKAVVWTDVFQVVVMLSGFWVVLARGV    141 - 210
MLVGGPRQVLTLAQNHSRINLMDFNPDPRSRYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKL    211 - 280
ALLINQVGLFLIVSSAACCGIVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSG    281 - 350
TLSTASTSINAMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM    351 - 420
GVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSAARCVALSVNA    421 - 490
SGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTVLCGALISCLTGPTKRSTLAP    491 - 560
GLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCV    561 - 630
GHDGGRDQQETNL                                                             631 - 643
//

Text Mined References (131)

PMID Year Title
26831514 2016 A systematic evaluation of sorting motifs in the sodium-iodide symporter (NIS).
26599396 2015 Glycosylation of Sodium/Iodide Symporter (NIS) Regulates Its Membrane Translocation and Radioiodine Uptake.
26285906 2015 Iodide transport and breast cancer.
26282166 2015 The miR-146b-3p/PAX8/NIS Regulatory Circuit Modulates the Differentiation Phenotype and Function of Thyroid Cells during Carcinogenesis.
26213306 2015 Upregulation of sodium iodide symporter (NIS) protein expression by an innate immunity component: Promising potential for targeting radiosensitive retinoblastoma.
26160439 2015 The potential role of the sodium iodide symporter gene polymorphism in the development of differentiated thyroid cancer.
25960292 2015 Inhibition of miR-146b expression increases radioiodine-sensitivity in poorly differential thyroid carcinoma via positively regulating NIS expression.
25955347 2015 Effect of sodium/iodide symporter (NIS)-mediated radioiodine therapy on estrogen receptor-negative breast cancer.
25842835 [Comparative analysis of activity of different promoters for NIS gene expression in melanoma cells].
25465605 2014 Mutation screening of the sodium iodide symporter gene in a cohort of 105 China patients with congenital hypothyroidism.
More...