Property Summary

NCBI Gene PubMed Count 137
PubMed Score 1016.45
PubTator Score 413.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7950 1.9e-06
psoriasis 6694 4.9e-04
facioscapulohumeral dystrophy 288 1.9e-03
uncontrolled asthma 56 8.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Congenital hypothyroidism 26 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
facioscapulohumeral dystrophy 2.300 1.9e-03
osteosarcoma 1.397 1.9e-06
psoriasis 1.300 4.9e-04
uncontrolled asthma 2.300 8.2e-03

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (108)

AA Sequence

MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVGLSLSASFMSA      1 - 70
VQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEYLEMRFSRAVRLCGTLQYIVA     71 - 140
TMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTAVGGMKAVVWTDVFQVVVMLSGFWVVLARGV    141 - 210
MLVGGPRQVLTLAQNHSRINLMDFNPDPRSRYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKL    211 - 280
ALLINQVGLFLIVSSAACCGIVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSG    281 - 350
TLSTASTSINAMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM    351 - 420
GVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSAARCVALSVNA    421 - 490
SGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTVLCGALISCLTGPTKRSTLAP    491 - 560
GLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCV    561 - 630
GHDGGRDQQETNL                                                             631 - 643
//

Text Mined References (137)

PMID Year Title