Property Summary

NCBI Gene PubMed Count 113
Grant Count 164
R01 Count 116
Funding $15,736,531.66
PubMed Score 243.53
PubTator Score 177.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92908 B0YJ17 P78327
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (92)

PMID Text
26505174 Our results, for the first time, portray a pivotal role of GATA6 in regulating metastatic behaviors of breast cancer cells
26387746 GATA6 induces expression of genes essential for growth of colon cancer cells under adherent conditions (REG4) and genes required for their clonogenicity (LGR5), and miR-363-GATA6-REG4/LGR5 signaling cascade promotes tumorigenicity of colon cancer cells.
25969542 data indicated that GATA-6 and Akt2 are involved in the mTORC1-mediated regulation of VSMC proliferation and differentiation.
25872572 miR-181b was upregulated by hypoxia in retinoblastoma in an HIF-1a-independent manner. Additionally, miR-181b exerts its angiogenic function, at least in part, by inhibiting PDCD10 and GATA6.
25706805 results show how genetic mutations in GATA6 may lead to functional inactivity and pancreatic agenesis in humans
25596178 In the pancreas, Gata6 acts as a tumour suppressor by enforcing acinar cell differentiation, by directly and indirectly repressing ectopic differentiation programmes, and by regulating crucial cancer-related gene expression pathways.
25445407 GATA6 expression is progressively increased during Barrett's oesophagus development and its malignant transformation to esophageal adenocarcinoma.
25119427 association of GATA6 loss-of-function mutations with enhanced susceptibility to familial dilated cardiomyopathy
25053715 KLF5/GATA4/GATA6 may promote gastric cancer development by engaging in mutual crosstalk, collaborating to maintain a pro-oncogenic transcriptional regulatory network in gastric cancer cells.
25036032 SNPs within the GATA6 gene promoter identified in ventricular septal defects patients may change GATA6 levels, contributing to the VSD development as a risk factor.
More...

AA Sequence

MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNCGTPQLDTEAA      1 - 70
AGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFA     71 - 140
PEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPGLPYHLQGSGS    141 - 210
GPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPG    211 - 280
GYAAAGSGGAGGVSGGGSSLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWP    281 - 350
AGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM    351 - 420
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT    421 - 490
RKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSEL    491 - 560
KYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA                                       561 - 595
//

Text Mined References (117)

PMID Year Title
26505174 2015 GATA6 is overexpressed in breast cancer and promotes breast cancer cell epithelial-mesenchymal transition by upregulating slug expression.
26387746 2015 REG4 is a transcriptional target of GATA6 and is essential for colorectal tumorigenesis.
25969542 2015 Phosphorylation of GATA-6 is required for vascular smooth muscle cell differentiation after mTORC1 inhibition.
25872572 2015 Hypoxia-induced miR-181b enhances angiogenesis of retinoblastoma cells by targeting PDCD10 and GATA6.
25706805 2015 Novel GATA6 mutations in patients with pancreatic agenesis and congenital heart malformations.
25596178 2016 The acinar regulator Gata6 suppresses KrasG12V-driven pancreatic tumorigenesis in mice.
25445407 2015 GATA6 expression in Barrett's oesophagus and oesophageal adenocarcinoma.
25119427 2014 GATA6 loss-of-function mutations contribute to familial dilated cardiomyopathy.
25053715 2015 Regulatory crosstalk between lineage-survival oncogenes KLF5, GATA4 and GATA6 cooperatively promotes gastric cancer development.
25036032 2014 Novel and functional DNA sequence variants within the GATA6 gene promoter in ventricular septal defects.
More...