Property Summary

NCBI Gene PubMed Count 120
PubMed Score 265.81
PubTator Score 177.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
ATRIAL FIBRILLATION, FAMILIAL, 1 (disorder) 21
ATRIOVENTRICULAR CANAL DEFECT 17
Abnormal nasal morphology 16
Abnormality of metabolism/homeostasis 134
Aortic coarctation 30
Autosomal recessive predisposition 1442
Bilateral fifth finger clinodactyly 110
Brachydactyly 156
Broad forehead 59
Broad hallux 29
CONOTRUNCAL HEART MALFORMATIONS (disorder) 6
Cognitive delay 608
Congenital hypoplasia of pancreas 2
Cryptorchidism 296
Curvature of little finger 110
Diaphragmatic Hernia 40
Discordant ventriculoarterial connection 17
Double Outlet Right Ventricle 11
Dull intelligence 645
Endocardial Cushion Defects 17
Exocrine pancreatic insufficiency 32
Exophthalmos 112
Failure to gain weight 365
Feeding difficulties 127
Fetal Growth Retardation 189
Foramen Ovale, Patent 10
Global developmental delay 608
Glycosuria 29
Hyperglycemia 137
Infant, Small for Gestational Age 176
Intellectual disability 1016
Intermittent diarrhea 5
Interrupted aortic arch 4
Intrauterine retardation 176
Long narrow head 75
Low Birth Weights 69
Low intelligence 645
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Muscular ventricular septum defect 1
Narrow cranium shape 75
Narrow head shape 75
Narrow skull shape 75
Neonatal insulin-dependent diabetes mellitus 6
Ostium secundum atrial septal defect 9
POLYDACTYLY, POSTAXIAL 13
Pancreatic Insufficiency 13
Pancreatic aplasia 1
Partial atrioventricular canal 5
Patent ductus arteriosus 90
Pediatric failure to thrive 365
Perimembranous ventricular septal defect 3
Persistant truncus arteriosus 17
Poor school performance 645
Preauricular Fistulae, Congenital 27
Preauricular dimple 27
Preauricular sinus 27
Prominent eyes 96
Prominent globes 96
Protruding eyes 96
Pulmonary Stenosis 45
Small for gestational age (disorder) 69
Thin lips 49
Turridolichocephaly 75
Underdeveloped brows 38
Underdeveloped supraorbital ridges 38
Ventricular Septal Defects 119
Yorifuji Okuno syndrome 1
diabetes mellitus 1728
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Atrial heart septal defect 18 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.500 9.1e-03
Atopic dermatitis -1.400 1.3e-03
atypical teratoid / rhabdoid tumor 2.100 2.4e-02
Barrett's esophagus 2.200 4.3e-02
Breast cancer -1.700 3.6e-05
cystic fibrosis -1.580 6.8e-05
esophageal adenocarcinoma 3.300 1.8e-02
interstitial cystitis -1.100 8.6e-03
intraductal papillary-mucinous adenoma (... 1.100 1.0e-03
lung adenocarcinoma -2.000 1.2e-08
lung cancer -1.600 6.2e-03
lung carcinoma -1.200 3.2e-23
malignant mesothelioma -4.400 1.8e-09
medulloblastoma, large-cell 2.400 1.8e-02
nasopharyngeal carcinoma 1.500 1.4e-03
non-small cell lung cancer -2.671 3.7e-20
ovarian cancer -5.300 2.6e-06
Polycystic ovary syndrome 1.504 2.2e-02
psoriasis -1.400 2.5e-05
sonic hedgehog group medulloblastoma 1.900 1.2e-02
ulcerative colitis -1.200 4.9e-04
X-linked cerebral adrenoleukodystrophy 2.100 4.3e-02

Gene RIF (98)

AA Sequence

MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNCGTPQLDTEAA      1 - 70
AGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFA     71 - 140
PEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPGLPYHLQGSGS    141 - 210
GPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPG    211 - 280
GYAAAGSGGAGGVSGGGSSLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWP    281 - 350
AGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM    351 - 420
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT    421 - 490
RKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSEL    491 - 560
KYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA                                       561 - 595
//

Text Mined References (125)

PMID Year Title