Property Summary

NCBI Gene PubMed Count 113
PubMed Score 243.53
PubTator Score 177.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 3.22618754251442E-23
non-small cell lung cancer 2798 3.7188441969126E-20
malignant mesothelioma 3163 1.8163563776351E-9
lung adenocarcinoma 2714 1.21237553091602E-8
ovarian cancer 8492 2.59620961131721E-6
psoriasis 6685 2.52440635881681E-5
Breast cancer 3099 3.62273747740754E-5
cystic fibrosis 1670 6.78578368442099E-5
lung cancer 4473 1.45473917123024E-4
ulcerative colitis 2087 4.89883195461049E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0010104466040792
Atopic dermatitis 944 0.00131671034596933
nasopharyngeal carcinoma 1056 0.00143388655715901
interstitial cystitis 2299 0.00861999977393049
adrenocortical carcinoma 1427 0.00906442160432614
sonic hedgehog group medulloblastoma 1482 0.0120813191293818
esophageal adenocarcinoma 737 0.0176010007179145
medulloblastoma, large-cell 6234 0.0180723370306211
Polycystic Ovary Syndrome 335 0.021514045677223
atypical teratoid / rhabdoid tumor 4369 0.0244775836779141
Barrett's esophagus 185 0.0432832081748007
X-linked cerebral adrenoleukodystrophy 115 0.0433320423147344
Disease Target Count Z-score Confidence
Atrial heart septal defect 15 0.0 4.0

Expression

Synonym

Accession Q92908 B0YJ17 P78327
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (92)

PMID Text
26505174 Our results, for the first time, portray a pivotal role of GATA6 in regulating metastatic behaviors of breast cancer cells
26387746 GATA6 induces expression of genes essential for growth of colon cancer cells under adherent conditions (REG4) and genes required for their clonogenicity (LGR5), and miR-363-GATA6-REG4/LGR5 signaling cascade promotes tumorigenicity of colon cancer cells.
25969542 data indicated that GATA-6 and Akt2 are involved in the mTORC1-mediated regulation of VSMC proliferation and differentiation.
25872572 miR-181b was upregulated by hypoxia in retinoblastoma in an HIF-1a-independent manner. Additionally, miR-181b exerts its angiogenic function, at least in part, by inhibiting PDCD10 and GATA6.
25706805 results show how genetic mutations in GATA6 may lead to functional inactivity and pancreatic agenesis in humans
25596178 In the pancreas, Gata6 acts as a tumour suppressor by enforcing acinar cell differentiation, by directly and indirectly repressing ectopic differentiation programmes, and by regulating crucial cancer-related gene expression pathways.
25445407 GATA6 expression is progressively increased during Barrett's oesophagus development and its malignant transformation to esophageal adenocarcinoma.
25119427 association of GATA6 loss-of-function mutations with enhanced susceptibility to familial dilated cardiomyopathy
25053715 KLF5/GATA4/GATA6 may promote gastric cancer development by engaging in mutual crosstalk, collaborating to maintain a pro-oncogenic transcriptional regulatory network in gastric cancer cells.
25036032 SNPs within the GATA6 gene promoter identified in ventricular septal defects patients may change GATA6 levels, contributing to the VSD development as a risk factor.
More...

AA Sequence

MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNCGTPQLDTEAA      1 - 70
AGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFA     71 - 140
PEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPGLPYHLQGSGS    141 - 210
GPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPG    211 - 280
GYAAAGSGGAGGVSGGGSSLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWP    281 - 350
AGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM    351 - 420
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT    421 - 490
RKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSEL    491 - 560
KYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA                                       561 - 595
//

Text Mined References (117)

PMID Year Title
26505174 2015 GATA6 is overexpressed in breast cancer and promotes breast cancer cell epithelial-mesenchymal transition by upregulating slug expression.
26387746 2015 REG4 is a transcriptional target of GATA6 and is essential for colorectal tumorigenesis.
25969542 2015 Phosphorylation of GATA-6 is required for vascular smooth muscle cell differentiation after mTORC1 inhibition.
25872572 2015 Hypoxia-induced miR-181b enhances angiogenesis of retinoblastoma cells by targeting PDCD10 and GATA6.
25706805 2015 Novel GATA6 mutations in patients with pancreatic agenesis and congenital heart malformations.
25596178 2016 The acinar regulator Gata6 suppresses KrasG12V-driven pancreatic tumorigenesis in mice.
25445407 2015 GATA6 expression in Barrett's oesophagus and oesophageal adenocarcinoma.
25119427 2014 GATA6 loss-of-function mutations contribute to familial dilated cardiomyopathy.
25053715 2015 Regulatory crosstalk between lineage-survival oncogenes KLF5, GATA4 and GATA6 cooperatively promotes gastric cancer development.
25036032 2014 Novel and functional DNA sequence variants within the GATA6 gene promoter in ventricular septal defects.
More...