Property Summary

NCBI Gene PubMed Count 64
Grant Count 33
R01 Count 19
Funding $5,969,212.4
PubMed Score 146.90
PubTator Score 119.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.600 0.000

Gene RIF (46)

PMID Text
25994644 analysis demonstrated that SNP260 of DAZL did not contribute to oligo/azoospermia while SNP386 was correlated to male infertility
25323654 Neither the A260G nor the A386G polymorphism of DAZL appeared to be involved in male infertility.
24717865 analysis of T12A and T54A polymorphisms role in the development of male infertility (Meta-Analysis)
24459810 Amniotic fluid-derived stem cells (AFSc) seem to express Nodal, Nanog and DAZL and it speculated that the regulation of self-renewal in AFSc could be similar as in human embryonic stem cells.
24086306 demonstrate that Boll is also transiently expressed during oogenesis in the fetal mouse ovary, but is simultaneously co-expressed within the same germ cells as Dazl
24015185 Abnormal DNA methylation of the DAZL promoter might represent an epigenetic marker of male infertility.
23678708 The A260G and A386G polymorphisms of the DAZL gene are not correlated with astheno-teratozoospermia-induced male infertility in the Han Chinese population.
22752612 study identified the core promoter of the DAZL gene; also provided preliminary evidence for the role of a novel SNP of the DAZL gene promoter in spermatogenic failure
22329245 results showed no significant differences in the frequency of DAZL AG (P = 0.58) and MTHFR CT (P = 0.44) between oligozoospermic infertile men and controls
22162380 overexpression of VASA and or DAZL, in both embryonic and induced pluripotent stem cells promoted differentiation into primordial germ cells, and maturation and progression through meiosis was enhanced.
More...

AA Sequence

MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK      1 - 70
IITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQ     71 - 140
NVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYS    141 - 210
AVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDK    211 - 280
RVHHFRRSRAMLKSV                                                           281 - 295
//

Text Mined References (68)

PMID Year Title
25994644 Association of polymorphisms of A260G and A386G in DAZL gene with male infertility: a meta-analysis and systemic review.
25323654 2014 Analysis of DAZL SNP260 and SNP386 in infertile Chinese males using multi-analyte suspension array.
24717865 2014 Association between DAZL polymorphisms and susceptibility to male infertility: systematic review with meta-analysis and trial sequential analysis.
24459810 2013 Nodal, Nanog, DAZL and SMAD gene expression in human amniotic fluid stem cells.
24086306 2013 A developmental stage-specific switch from DAZL to BOLL occurs during fetal oogenesis in humans, but not mice.
24015185 2013 Altered DNA methylation patterns of the H19 differentially methylated region and the DAZL gene promoter are associated with defective human sperm.
23678708 2013 [DAZL gene polymorphisms and astheno-teratozoospermia].
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
22752612 2012 A single-nucleotide polymorphism of the DAZL gene promoter confers susceptibility to spermatogenic failure in the Taiwanese Han.
22329245 2011 DAZL 260A > G and MTHFR 677C > T variants in sperm DNA of infertile Indian men.
More...