Property Summary

NCBI Gene PubMed Count 69
PubMed Score 156.17
PubTator Score 119.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Testicular Germ Cell Tumor 14 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.0e-22

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.600 4.0e-22

Gene RIF (51)

AA Sequence

MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK      1 - 70
IITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQ     71 - 140
NVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYS    141 - 210
AVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDK    211 - 280
RVHHFRRSRAMLKSV                                                           281 - 295
//

Text Mined References (73)

PMID Year Title