Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.84
PubTator Score 1.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Neoplasm Invasiveness 161 0.0 0.0
Disease Target Count P-value
Duchenne muscular dystrophy 601 5.6e-10
acute quadriplegic myopathy 1158 3.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Polycystic kidney disease 1 21 3.481 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.659 3.2e-06
Duchenne muscular dystrophy -1.368 5.6e-10

Synonym

Accession Q92901
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREVHRPGLKISKR      1 - 70
EEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYKDWHKSKKKAFTKACKRWRDT     71 - 140
DGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAHIMEIQLNGGTVAEKVAWAQARLEKQVPVHSV    141 - 210
FSQSEVIDVIAVTKGRGVKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTEL    211 - 280
NKKIFRIGRGPHMEDGKLVKNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKS    281 - 350
LLVHHSRQAVENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL                 351 - 407
//

Text Mined References (10)

PMID Year Title