Property Summary

NCBI Gene PubMed Count 100
Grant Count 78
R01 Count 50
Funding $10,378,751.44
PubMed Score 202.11
PubTator Score 140.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.167 0.005
breast carcinoma 1.900 0.004
ovarian cancer 1.300 0.002

Synonym

Accession Q92900 O00239 O43343 Q86Z25 Q92842
Symbols HUPF1
NORF1
RENT1
smg-2
pNORF1

Gene

PDB

2GJK   2GK6   2GK7   2IYK   2WJV   2WJY   2XZO   2XZP  

Gene RIF (60)

PMID Text
26759305 Study showed that UPF1 was down-regulated due to promoter hypermethylation in hepatocellular carcinoma tissues which correlated with decreased survival.
26656492 CARM1 associates with major nonsense-mediated mRNA decay factor UPF1 and promotes its occupancy on premature terminating codon-containing transcripts in spinal muscular atrophy.
26253027 Results present evidence for a critical role for Upf1 ATPase activity in nonsense-mediated decay target discrimination, with preferential ATPase-dependent release of Upf1 from non-target mRNAs as part of the underlying mechanism.
26138914 Upf1 is a RNA helicase essential for nonsense-mediated mRNA decay. Once recruited onto NMD mRNA targets, Upf1 can scan the entire transcript to irreversibly remodel the mRNP, facilitating its degradation by the NMD machinery.
25775514 GR and PNRC2 interact in a ligand-dependent manner to recruit UPF1 for rapid mRNA degradation
25211080 Depletion of nonsense-mediated mRNA decay pathway components Upf1, Smg5, and Smg7 led to increased levels of viral proteins and and virus release.
25184677 3' UTR-associated UPF1 undergoes regulated phosphorylation on NMD targets, providing a binding platform for mRNA degradative activities
25053839 SMG6 requires UPF1 and SMG1 for nonsense-mediated mRNA decay.
25013172 The study demonstrates that SMG5-SMG7 and SMG6 exhibit different and non-overlapping modes of UPF1 recognition, thus pointing at distinguished roles in integrating the complex nonsense-mediated mRNA decay interaction network.
24859531 Adenosquamous carcinomas frequently harbor somatically acquired mutations in the UPF1 gene which alter RNA splicing and perturb nonsense-mediated RNA decay.
More...

AA Sequence

MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAA      1 - 70
AGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTS     71 - 140
KKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCR    141 - 210
QPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDL    211 - 280
EKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKT    281 - 350
DSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNF    351 - 420
QVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAV    421 - 490
KTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSR    491 - 560
EAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVG    561 - 630
AGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLV    631 - 700
VLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIAS    701 - 770
SGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAF    771 - 840
QGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLV    841 - 910
EGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMI    911 - 980
SAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQ    981 - 1050
ASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQH   1051 - 1120
GGVTGLSQY                                                                1121 - 1129
//

Text Mined References (113)

PMID Year Title
26759305 2016 The human RNA surveillance factor UPF1 regulates tumorigenesis by targeting Smad7 in hepatocellular carcinoma.
26656492 2016 A novel role for CARM1 in promoting nonsense-mediated mRNA decay: potential implications for spinal muscular atrophy.
26255671 2015 Regnase-1 and Roquin regulate inflammatory mRNAs.
26253027 2015 Target Discrimination in Nonsense-Mediated mRNA Decay Requires Upf1 ATPase Activity.
26138914 2015 Human Upf1 is a highly processive RNA helicase and translocase with RNP remodelling activities.
26000482 2015 Regnase-1 and Roquin Regulate a Common Element in Inflammatory mRNAs by Spatiotemporally Distinct Mechanisms.
25775514 2015 Glucocorticoid receptor interacts with PNRC2 in a ligand-dependent manner to recruit UPF1 for rapid mRNA degradation.
25211080 2014 The host nonsense-mediated mRNA decay pathway restricts Mammalian RNA virus replication.
25184677 2014 A post-translational regulatory switch on UPF1 controls targeted mRNA degradation.
25053839 2014 A novel phosphorylation-independent interaction between SMG6 and UPF1 is essential for human NMD.
More...