Property Summary

NCBI Gene PubMed Count 29
PubMed Score 79.77
PubTator Score 48.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer -1.200 1.4e-15
acute quadriplegic myopathy 1.146 3.9e-04
adrenocortical carcinoma 1.051 2.2e-05
astrocytoma 2.000 2.0e-04
Down syndrome 1.100 9.5e-03
invasive ductal carcinoma -1.200 7.7e-03
juvenile dermatomyositis 1.187 3.0e-09
lung adenocarcinoma 1.142 2.9e-04
malignant mesothelioma -1.300 3.4e-06
oligodendroglioma 1.100 9.5e-03
osteosarcoma 2.950 3.8e-06
ovarian cancer -1.500 4.1e-08
pancreatic ductal adenocarcinoma liver m... 1.397 4.2e-02
Pick disease 1.400 5.7e-06
psoriasis 1.300 2.6e-04

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MAACGRVRRMFRLSAALHLLLLFAAGAEKLPGQGVHSQGQGPGANFVSFVGQAGGGGPAGQQLPQLPQSS      1 - 70
QLQQQQQQQQQQQQPQPPQPPFPAGGPPARRGGAGAGGGWKLAEEESCREDVTRVCPKHTWSNNLAVLEC     71 - 140
LQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVCKSTITEIKECADEPVGKGYMVSCLVDHRGN    141 - 210
ITEYQCHQYITKMTAIIFSDYRLICGFMDDCKNDINILKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEE    211 - 280
REPKIQVSELCKKAILRVAELSSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEK    281 - 350
CREALTTRQKLIAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQ    351 - 420
GEMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNCQQALQTLIQE    421 - 490
TDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVEDCEHRLLELQYFISRDWKLD    491 - 560
PVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHAYRTEEQGRRLSRECRAEVQRILHQRAMDVK    561 - 630
LDPALQDKCLIDLGKWCSEKTETGQELECLQDHLDDLVVECRDIVGNLTELESEDIQIEALLMRACEPII    631 - 700
QNFCHDVADNQIDSGDLMECLIQNKHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNI    701 - 770
KKKVDVVICLSTTVRNDTLQEAKEHRVSLKCRRQLRVEELEMTEDIRLEPDLYEACKSDIKNFCSAVQYG    771 - 840
NAQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTMLQCLKQNKNS    841 - 910
ELMDPKCKQMITKRQITQNTDYRLNPMLRKACKADIPKFCHGILTKAKDDSELEGQVISCLKLRYADQRL    911 - 980
SSDCEDQIRIIIQESALDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEV    981 - 1050
LNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWS   1051 - 1120
YAAKVAPADGFSDLAMQVMTSPSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDR              1121 - 1179
//

Text Mined References (36)

PMID Year Title