Property Summary

NCBI Gene PubMed Count 28
PubMed Score 74.10
PubTator Score 48.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.20896292170173E-11
ovarian cancer 8492 2.67606564321118E-6
malignant mesothelioma 3163 3.44465988173675E-6
osteosarcoma 7933 3.78248510963928E-6
Pick disease 1893 5.71984903334606E-6
lung adenocarcinoma 2714 1.49762935201808E-5
adrenocortical carcinoma 1427 2.18184883836044E-5
psoriasis 6685 2.63989762625481E-4
astrocytoma 1493 3.26576588780428E-4
acute quadriplegic myopathy 1157 3.91933261652487E-4
invasive ductal carcinoma 2950 0.00765287748078232
oligodendroglioma 2849 0.00945655813599454
Down syndrome 548 0.0095272287487812
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0423076411594774
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 2.0
Disease Target Count Z-score Confidence
Amyotrophic Lateral Sclerosis 432 3.164 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
oligodendroglioma 1.100 0.009
psoriasis 1.300 0.000
osteosarcoma 2.950 0.000
astrocytoma 2.600 0.000
juvenile dermatomyositis 1.604 0.000
acute quadriplegic myopathy 1.146 0.000
adrenocortical carcinoma 1.051 0.000
pancreatic ductal adenocarcinoma liver m... 1.397 0.042
lung adenocarcinoma 1.441 0.000
Pick disease 1.400 0.000
Breast cancer -1.200 0.000
invasive ductal carcinoma -1.200 0.008
ovarian cancer 2.500 0.000
Down syndrome 1.100 0.010

Synonym

Accession Q92896 B7Z8Y4 D3DUJ7 Q13221 Q6P9D1
Symbols CFR-1
ESL-1
MG160
MG-160

Gene

  Ortholog (10)

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26792720 Our results highlight the fact that interaction between APN and ESL-1 could provide a fundamental mechanism underlying the anti-atherogenic properties of APN.
25301730 circulating prostate cancer cells' rolling capacity contributes to metastasis, and that is in part controlled by ESL-1.
22021370 Studies indicate that PSGL-1, CD44, and ESL-1 on mature leukocytes are physiologic glycoprotein ligands for endothelial P-selectin and E-selectin.
21777203 expression of Cfr in the Golgi apparatus and on the plasma membrane is finely tuned through two distinct mechanisms for exhibiting different functions.
21283832 C2GnT1 gene expression and the resulting C2-O-sLe(X) carbohydrates produced mediate the adhesive and invasive behaviors of human carcinomas which may influence their metastatic potential.
19844255 Observational study of gene-disease association. (HuGE Navigator)
19148508 under hypoxia, ESL-1 is shed from activated hepatic stellate cells
18463975 Genome-wide association study of gene-disease association. (HuGE Navigator)
15797922 a novel variant of the GLG1 gene product called GLG2 is reported; genetic analysis suggests GLG1 & GLG2 are the products of a single gene, the mRNA of which can be processed by alternative splicing to generate different transcripts encoding GLG1 or GLG2
12684670 evaluated in human brain tumors exhibiting varying degrees of malignancy

AA Sequence

MAACGRVRRMFRLSAALHLLLLFAAGAEKLPGQGVHSQGQGPGANFVSFVGQAGGGGPAGQQLPQLPQSS      1 - 70
QLQQQQQQQQQQQQPQPPQPPFPAGGPPARRGGAGAGGGWKLAEEESCREDVTRVCPKHTWSNNLAVLEC     71 - 140
LQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVCKSTITEIKECADEPVGKGYMVSCLVDHRGN    141 - 210
ITEYQCHQYITKMTAIIFSDYRLICGFMDDCKNDINILKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEE    211 - 280
REPKIQVSELCKKAILRVAELSSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEK    281 - 350
CREALTTRQKLIAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQ    351 - 420
GEMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNCQQALQTLIQE    421 - 490
TDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVEDCEHRLLELQYFISRDWKLD    491 - 560
PVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHAYRTEEQGRRLSRECRAEVQRILHQRAMDVK    561 - 630
LDPALQDKCLIDLGKWCSEKTETGQELECLQDHLDDLVVECRDIVGNLTELESEDIQIEALLMRACEPII    631 - 700
QNFCHDVADNQIDSGDLMECLIQNKHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNI    701 - 770
KKKVDVVICLSTTVRNDTLQEAKEHRVSLKCRRQLRVEELEMTEDIRLEPDLYEACKSDIKNFCSAVQYG    771 - 840
NAQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTMLQCLKQNKNS    841 - 910
ELMDPKCKQMITKRQITQNTDYRLNPMLRKACKADIPKFCHGILTKAKDDSELEGQVISCLKLRYADQRL    911 - 980
SSDCEDQIRIIIQESALDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEV    981 - 1050
LNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWS   1051 - 1120
YAAKVAPADGFSDLAMQVMTSPSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDR              1121 - 1179
//

Text Mined References (35)

PMID Year Title
26792720 2016 E-selectin ligand-1 (ESL-1) is a novel adiponectin binding protein on cell adhesion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25301730 2014 E-selectin ligand-1 controls circulating prostate cancer cell rolling/adhesion and metastasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22021370 2011 Leukocyte ligands for endothelial selectins: specialized glycoconjugates that mediate rolling and signaling under flow.
21777203 2011 Retention in the Golgi apparatus and expression on the cell surface of Cfr/Esl-1/Glg-1/MG-160 are regulated by two distinct mechanisms.
21283832 2011 C2-O-sLeX glycoproteins are E-selectin ligands that regulate invasion of human colon and hepatic carcinoma cells.
More...