Property Summary

NCBI Gene PubMed Count 36
Grant Count 52
R01 Count 34
Funding $4,242,227.28
PubMed Score 53.50
PubTator Score 50.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 0.006
pancreatic ductal adenocarcinoma liver m... -1.306 0.015
lung cancer 1.100 0.033
ovarian cancer 2.000 0.000
Breast cancer 1.200 0.000

Gene RIF (21)

PMID Text
26112410 The study revealed a regulatory role of the p97-Npl4-Ufd1 complex in regulating a partial degradation of the NF-kappaB subunit p100.
24429874 p97-Ufd1-Npl4 is an integral part of G2/M checkpoint signaling and thereby suppresses chromosome instability.
24248593 Data indicate that the p97-UFD1L-NPL4 protein complex specifically associates with ubiquitinated IkappaBalpha via the interactions between p97 and the SCF(beta-TRCP) ubiquitin ligase.
24019527 In coordination with the P97-UFD1-NPL4 complex (P97(UFD1/NPL4)), NUB1L promotes transfer of NEDD8 to proteasome for degradation.
23623450 This study demonistrated that UFD1L may participate in the core cognitive deficits observed in schizophrenia.
23293021 Data indicate that Npl4-Ufd1 heterodimer is required for VCP-FAF1 interaction.
22763378 increased corpus callosum volume in children with 22q11DS is associated with UFD1L polymorphism.
21571647 Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control
21486945 Data establish Cdc48/p97-Ufd1-Npl4 as a crucial negative regulator of Aurora B early in mitosis of human somatic cells and suggest that the activity of Aurora B on chromosomes needs to be restrained to ensure faithful chromosome segregation.
20702414 Data suggest that the human cytomegalovirus dislocation reaction in US2 cells is independent of the p97 cofactor Ufd1-Npl4, and different retrotranslocation mechanisms can employ distinct p97 ATPase complexes to dislocate substrates.
More...

AA Sequence

MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLT      1 - 70
NKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKA     71 - 140
VLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST    141 - 210
EGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKK    211 - 280
VEEDEAGGRFVAFSGEGQSLRKKGRKP                                               281 - 307
//

Text Mined References (44)

PMID Year Title
26112410 2015 The Transitional Endoplasmic Reticulum ATPase p97 Regulates the Alternative Nuclear Factor NF-?B Signaling via Partial Degradation of the NF-?B Subunit p100.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24429874 2014 The p97-Ufd1-Npl4 ATPase complex ensures robustness of the G2/M checkpoint by facilitating CDC25A degradation.
24248593 2014 The p97-UFD1L-NPL4 protein complex mediates cytokine-induced I?B? proteolysis.
24089527 2013 Caveolin-1 interacts with Derlin-1 and promotes ubiquitination and degradation of cyclooxygenase-2 via collaboration with p97 complex.
24019527 2013 NEDD8 ultimate buster-1 long (NUB1L) protein promotes transfer of NEDD8 to proteasome for degradation through the P97UFD1/NPL4 complex.
23623450 2013 Polymorphisms in schizophrenia candidate gene UFD1L may contribute to cognitive deficits.
23293021 2013 Complex of Fas-associated factor 1 (FAF1) with valosin-containing protein (VCP)-Npl4-Ufd1 and polyubiquitinated proteins promotes endoplasmic reticulum-associated degradation (ERAD).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22763378 2012 Increased corpus callosum volume in children with chromosome 22q11.2 deletion syndrome is associated with neurocognitive deficits and genetic polymorphisms.
More...