Property Summary

NCBI Gene PubMed Count 173
Grant Count 129
R01 Count 75
Funding $8,797,766.67
PubMed Score 252.46
PubTator Score 213.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.100 0.002
hepatocellular carcinoma 1.600 0.000
pancreatic cancer 1.100 0.006
psoriasis 1.400 0.001
osteosarcoma 2.161 0.000
glioblastoma 1.100 0.001
medulloblastoma, large-cell 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.369 0.005
diabetes mellitus -1.100 0.006
posterior fossa group B ependymoma 1.100 0.000
pancreatic carcinoma 1.100 0.006

Synonym

Accession Q92889 A5PKV6 A8K111 O00140 Q8TD83
Symbols XPF
RAD1
FANCQ
XFEPS
ERCC11

Gene

PDB

1Z00   2A1J   2AQ0   2KN7   2MUT  

Gene RIF (156)

PMID Text
26453996 SLX4 (FANCP) and XPF (FANCQ) proteins interact with each other and play a vital role in the Fanconi anemia (FA) DNA repair pathway.
26411687 Helicobacter Pylori introduces double-stranded DNA breaks by the nucleotide excision repair endonucleases XPF and XPG, which, together with RelA, are recruited to chromatin in a highly coordinated, type IV secretion system-dependent manner.
26085086 F231L mutation results in only a small disturbance of the ERCC1-XPF interface, where, in contrast to Phe(231), Leu(231) lacks interactions stabilizing the ERCC1-XPF complex
26074087 ERCC4 is located on human chromosome 16p13.12 and consists of 11 exons spanning about 28.2 kb, the broad tissue expression pattern of ERCC4 is similar to that of ERCC1; ERCC1 and ERCC4 genes encode the two subunits of the ERCC1-XPF nuclease. This enzyme plays an important role in repair of DNA damage and in maintaining genomic stability. [Review]
26045829 Genotypes of ERCC1 (rs11615, rs3212986 and rs2298881) and XPF (rs2276465 and rs6498486) were performed by Polymerase Chain Reaction Restriction Fragment Length Polymorphism (PCR-RFLP) assay
26025908 ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex. ERCC1-XPF and RPA form a DNA/protein complex on the nick DNA substrate.
25879486 Mus81-deficient cells fail to recover from exposure to low doses of replication inhibitors and cell viability is dependent on the XPF endonuclease.
25730007 we found no association between the rs11615 of the ERCC1 and rs2276466 of the XPF polymorphisms and the risk of colorectal cancer
25538220 these results establish USP45 as a new regulator of XPF-ERCC1 crucial for efficient DNA repair
25535740 XPF and XPC expression may be a potential predictive factor for bladder cancer, and smoking can not only influence the recurrence of bladder cancer as a single factor but also aggravate the results of the XPF defect and XPC defect.
25342505 This meta-analysis suggests that the 3 common XPF polymorphisms rs744154, rs6498486, and rs1799801 are not associated with gastric cancer risk.
25292041 ERCC4 rs1800067 polymorphism is not associated with cancer risk.
25019640 Low XPF expression in head and neck squamous cell carcinoma patients is associated with better response to induction chemoradiotherapy, while high XPF expression correlates with a worse response.
24938470 Our study suggests that the rs1800067 genetic variant of XPF functions in the development of glioma.
24861646 no significant associations between XPF polymorphisms in rs2276466 or rs6498486 and risk of colorectal cancer in a Chinese population
24795708 Co-immunoprecipitation and glycerol-gradient sedimentation demonstrate that HIV-1 Vpr, VPRBP, DDB1, SLX4, MUS81, EME1, ERCC1, and ERCC4 form a complex
24709955 genetic variants in XPF might contribute to the susceptibility to ESCC
24528857 Co-immunoprecipitation and glycerol-gradient sedimentation demonstrate that HIV-1 Vpr, VPRBP, DDB1, SLX4, MUS81, EME1, ERCC1, and ERCC4 form a complex
24465539 The contribution of ERCC4/FANCQ coding mutations to hereditary breast cancer in Central and Eastern Europe is likely to be small.
24412650 Co-immunoprecipitation and glycerol-gradient sedimentation demonstrate that HIV-1 Vpr, VPRBP, DDB1, SLX4, MUS81, EME1, ERCC1, and ERCC4 form a complex
24412486 The C2169A nonsense mutation in XPF protein is closely associated with gastric carcinogenesis in the Chinese population.The XPF mutation is largely monoallelic indicating the haplo-insufficiency of XPF.
24318989 ERCC1 (rs11615, rs3212986C>A, and rs2298881) and ERCC4 (rs226466C>G, rs2276465, and rs6498486) were selected and genotyped
24027083 the frequency of Spanish individuals heterozygous for pathogenic mutations in the ERCC4 gene is approximately 0.3%, and it does not differ between familial breast/ovarian cancer patients and healthy controls.
24004570 ERCC4 rs1800124 and MBD4 rs10342 non-synonymous single nucleotide polymorphism variants were associated with DNA repair capacity.
23991957 The rs1800067 G and rs2276466 G allele frequencies in Xeroderma pigmentosum complementation group f polymorphisms influence risk of glioma.
23982883 Overexpression of XPF decreased drug sensitivity in malignant melanoma.
23909490 The present study shows that the ERCC1 rs11615 and XPF rs6498486 polymorphisms are associated with breast cancer risk in a Chinese population.
23679285 Polymorphisms in rs180067, rs1799801, rs2276466 and rs744154 in XPF is associated with gastric cancer.
23623389 Malfunction of nuclease ERCC1-XPF results in diverse clinical manifestations and causes Cockayne syndrome, xeroderma pigmentosum, and Fanconi anemia.
23623386 Mutations in ERCC4, encoding the DNA-repair endonuclease XPF, cause Fanconi anemia.
23580445 The compound interacts with the domain of XPF responsible for interaction with ERCC1.
23537993 a significantly decreased risk of gastric cancer associated with the ERCC4 rs744154 GC/CC genotypes in a Chinese population
23435956 individuals whose expression of XRCC1, ERCC4, ERCC2, and ERCC1 are reduced may be at a higher risk of developing squamous intraepithelial lesion which eventually leads to invasive cervical carcinoma.
23415627 The ERCC4 tagSNPs, rs6498486 and rs254942, may play protective roles in gastric carcinogenesis, especially in the development of atrophic gastritis.
23385459 Frameshift mutation XP11BE not only divests the XPF-interaction motif impairing DNA repair, but also reduces XPB solubility, leading to a lower intracellular level of transcription factor TFIIH and deficient transcription.
22848636 two SNPs (rs2276466 and rs3136038) in ERCC4 may be functional and contribute to SCCHN susceptibility
22771116 XPG endonuclease promotes DNA breaks and DNA demethylation at promoters allowing the recruitment of CTCF and gene looping, which is further stabilized by XPF.
22768293 This meta-analysis suggests a lack of statistical evidence for the association between the four XPF SNPs and overall risk of cancers.
22609620 There is no evidence that G1244A and T2505 single nucleotide polymorphisms in XPF affect expression of ERCC1.
22547097 Multiple DNA binding domains mediate the function of the ERCC1-XPF protein in nucleotide excision repair
22457069 XPF-ERCC1 has a preference for cleaving the phosphodiester bond positioned on the 3'-side of a T or a U, which is flanked by an upstream T or U suggesting that a T/U pocket may exist within the catalytic domain.
22353549 these results suggest that the interaction between XPF and Eg5 plays a role in mitosis and DNA repair and offer new insights into the pathogenesis of XP-F and XFE.
22212909 ERCC1-XPF dependent DNA repair is critical for protecting prostate epithelial from transformation to cancer
21896658 collaboration between hSNM1A and XPF-ERCC1 is necessary to initiate ICL repair in replicating human cells
21839691 This work reveals a new role for ERCC1 distinct from its known function in DNA repair, which may be independent of XPF.
21737503 Data show that high XPF expression correlated with early time to progression both by univariate and multivariate analysis.
21672525 These results indicated that persistent HBV infection might trigger NER impairment in part through upregulation of miR-192, which suppressed the levels of ERCC3 and ERCC4.
21424776 XPF Arg415Gln may be a low-penetrant risk factor in the Caucasian ethnicity for developing breast cancer.
21423097 results indicated that Arg399Gln polymorphism of XRCC1 gene and Arg415Gln polymorphism of ERCC4 gene may not be associated with smoking- and drinking-related larynx cancer in Polish population
21277872 The association of MPM with DNA repair genes support the hypothesis that an increased susceptibility to DNA damage may favour asbestos carcinogenicity.
20957144 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20864414 Observational study of gene-disease association. (HuGE Navigator)
20846399 Data indicate for the first time that the exceptional sensitivity of TTC and, therefore, very likely the curability of TGCT rests on their limited ICL repair due to low level of expression of ERCC1-XPF.
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20601096 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20518486 sites of interaction of FANCG with ERCC1, which is different from the region of ERCC1 that binds to XPF
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20429839 Studies indicate that a marginally statistically significant association was found for XRCC1 codon 399, XPD Asp312Asn and XRCC1 codon 194 variants and head and neck cancer.
20429839 Observational study of gene-disease association. (HuGE Navigator)
20372803 squamous cell carcinoma metastases of the head and neck show increased levels of nucleotide excision repair protein XPF in vivo that correlate with increased chemoresistance ex vivo
20221251 This demonstrates that at least part of the DNA repair defect and symptoms associated with mutations in XPF are due to mislocalization of XPF-ERCC1 into the cytoplasm of cells.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20199546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20183911 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20150366 Observational study of gene-disease association. (HuGE Navigator)
20062074 XPF promoter -357A>C polymorphism may regulate the expression of XPF and thereby contribute to susceptibility to and prognosis of bladder cancer.
20062074 Observational study of gene-disease association. (HuGE Navigator)
20061190 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19956886 ERCC1 and XPF are upregulated during testicular germ cell tumor progression
19920816 the role of a SNP in intron 1 of the ERCC4 gene (rs744154), previously reported to be associated with a reduced risk of breast cancer in the general population, as a breast cancer risk modifier in BRCA1 and BRCA2 mutation carriers.
19920816 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19902366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19434073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19423537 Our data provide persuasive evidence against an overall association between invasive breast cancer risk and ERCC4 rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 genotypes among women of European descent.
19423537 Meta-analysis of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19297315 The smoking status was also predictive of both RPA.. and XPF levels.. after adjusting for age, sex ...
19258314 a model for the mechanism of ICL repair in mammalian cells that implicates the DNA glycosylase activity of NEIL1 downstream of XPF/ERCC1 and translesion DNA synthesis repair steps.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124519 Variant ERCC4 genotypes are statistically significantly associated with benign breast disease, wspecially in women with a family history of breast cancer.
19124519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19029193 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18990748 Meta-analysis of gene-disease association. (HuGE Navigator)
18838045 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18812185 XPF-ERCC1 controls TRF2 and telomere length maintenance through two distinctive mechanisms, with the former requiring its nuclease activity
18767034 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18709642 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18701435 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18551366 Single nucleotide polymorphism in XPF is associated with breast cancer.
18551366 Observational study of gene-disease association. (HuGE Navigator)
18544627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18396111 To determine whether a human flap endonuclease could recognize and process this potential intermediate, the genetic requirement for the ERCC1/XPF heterodimer during LINE-1 retrotransposition was characterized
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18068852 the polymorphism rs3136038 on the promotor region of ERCC4 may contribute to the etiology of lung cancer.
18068852 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18026184 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18020456 Data show that incision deficiency correlates with reduced levels of DNA repair synthesis in Fanconi anemia cells and is not due to reduced levels of XPF.
18006494 These results implicate the XPF-ERCC1 complex in initiating interstrand cross-links (ICL) repair by unhooking the ICL, which simultaneously induces a double strand break at a stalled fork.
17945097 The gene polymorphism at ERCC4 gene had no effects on the DNA damage of lymphocytes in coke oven workers.
17945097 Observational study of gene-disease association. (HuGE Navigator)
17912758 The XPF HhH homodimer has a larger interaction interface, aromatic stacking interactions, and additional hydrogen bond contacts as compared to the XPF/ERCC1 HhH complex, which accounts for its higher stability
17685459 Observational study of gene-disease association. (HuGE Navigator)
17682675 Observational study of gene-disease association. (HuGE Navigator)
17682675 The results suggest that the Arg415Gln polymorphism in ERCC4/XPF may not be linked with appearance and development of breast cancer.
17575242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17438655 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17313739 Observational study of gene-disease association. (HuGE Navigator)
17299578 Meta-analysis of gene-disease association. (HuGE Navigator)
17210993 Observational study of gene-disease association. (HuGE Navigator)
17078101 Observational study of gene-disease association. (HuGE Navigator)
17055345 unanticipated nuclease-independent function of XPF in TRF2-mediated telomere shortening
17018596 Observational study of gene-disease association. (HuGE Navigator)
17018596 A SNP (rs744154) in intron 1 was associated with recessive protection from breast cancer after adjustment for multiple testing in stage 2. It is in the first intron, in a region that is highly conserved across species, and could be causal.
16823510 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16806697 Observational study of gene-disease association. (HuGE Navigator)
16806697 results suggest that the polymorphic variants of these NER genes do not contribute to the risk of developing AD.
16678501 XPF is required to form gamma-H2AX and likely double strand breaks in response to interstrand crosslinks in human cells
16638864 Observational study of gene-disease association. (HuGE Navigator)
16609022 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16537713 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16492920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16399771 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16393248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16338413 The ERCC1 domain folds properly only in the presence of the XPF domain, which implies a role for XPF as a scaffold for the folding of ERCC1.
16284380 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16284373 Observational study of gene-disease association. (HuGE Navigator)
16258177 Observational study of gene-disease association. (HuGE Navigator)
16195237 Observational study of gene-disease association. (HuGE Navigator)
16076955 XPF-ERCC1 recognizes a branched DNA substrate by binding the two ssDNA arms with the two HhH2 domains of XPF and ERCC1 and by binding the 5'-ssDNA arm with the central domain of ERCC1.
16034668 A nuclear magnetic resonance examination of the DNA binding site.
15936543 Observational study of gene-disease association. (HuGE Navigator)
15932882 The XPF binding sites of ERCC1 were located in helices H1 and H3 and in the C-terminal region, similar to the involved surface of XPF.
15886521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15886521 The combined effect of ERCC2 Asp(312)Asn and ERCC4 Ser(835)Ser genotypes might be associated with breast cancer risk in Korean women
15849729 Observational study of gene-disease association. (HuGE Navigator)
15184880 We show that RAD1 is an essential gene for sustained cell proliferation and that loss of Rad1 causes destabilization of Rad9 and Hus1 and consequently disintegration of the sliding-clamp complex.
15095299 XPA, ERCC1 and XPF DNA repair protein expression is reduced in testis neoplasms
14734547 the ternary complex of hRad52 and XPF/ERCC1 is the active species that processes recombination intermediates generated during the repair of DNA double strand breaks and in homology-dependent gene targeting events
14728600 XPF protein has important roles in psoralen ICL-mediated DNA repair and mutagenesis.
14690602 Data reveal an unanticipated involvement of the ERCC1/XPF NER endonuclease in the regulation of telomere integrity.
14652281 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14625810 Observational study of genotype prevalence. (HuGE Navigator)
11895912 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVLVLNTQPAEEE      1 - 70
YFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLTDRIPSDLITGILVYRAHRII     71 - 140
ESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVERVMRNLFVRKLYLWPRFHVAVNSFLEQHKPE    141 - 210
VVEIHVSMTPTMLAIQTAILDILNACLKELKCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAK    211 - 280
TKSLVQDLKILRTLLQYLSQYDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAK    281 - 350
MSKKEKISEKMEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQL    351 - 420
RDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERASTKERTLKKKKR    421 - 490
KLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSSDAAFGILKEPLTIIHPLLGC    491 - 560
SDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPGKPLRVYFLIYGGSTEEQRYLTALRKEKEAF    561 - 630
EKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIH    631 - 700
RRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLT    701 - 770
SRGALFQEISSNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPE    771 - 840
SEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVS    841 - 910
KGKGKK                                                                    911 - 916
//

Text Mined References (179)

PMID Year Title
26453996 2015 Physical interaction between SLX4 (FANCP) and XPF (FANCQ) proteins and biological consequences of interaction-defective missense mutations.
26411687 2015 H. pylori-Induced DNA Strand Breaks Are Introduced by Nucleotide Excision Repair Endonucleases and Promote NF-?B Target Gene Expression.
26085086 2015 The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
26074087 2015 The ERCC1 and ERCC4 (XPF) genes and gene products.
26045829 2015 Polymorphisms in ERCC1 and XPF gene and response to chemotherapy and overall survival of non-small cell lung cancer.
26025908 2015 Repair synthesis step involving ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex.
25879486 2015 The DNA repair endonuclease Mus81 facilitates fast DNA replication in the absence of exogenous damage.
25730007 2015 Association between ERCC1 and XPF polymorphisms and risk of colorectal cancer.
25538220 2015 USP45 deubiquitylase controls ERCC1-XPF endonuclease-mediated DNA damage responses.
25535740 2014 Attenuated NER expressions of XPF and XPC associated with smoking are involved in the recurrence of bladder cancer.
25342505 2014 Lack of association between XPF polymorphisms and gastric cancer risk: a meta-analysis.
25292041 2014 Associations of ERCC4 rs1800067 polymorphism with cancer risk: an updated meta-analysis.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25019640 2014 DNA repair biomarkers XPF and phospho-MAPKAP kinase 2 correlate with clinical outcome in advanced head and neck cancer.
24938470 2014 Association of polymorphisms of the xeroderma pigmentosum complementation group F gene with increased glioma risk.
24861646 2014 Association of single nucleotide polymorphisms of ERCC1 and XPF with colorectal cancer risk and interaction with tobacco use.
24780295 2014 Importance of EGFR/ERCC1 interaction following radiation-induced DNA damage.
24709955 2014 XPF-673C>T polymorphism effect on the susceptibility to esophageal cancer in Chinese population.
24465539 2014 Mutation analysis of the ERCC4/FANCQ gene in hereditary breast cancer.
24412486 2014 A nonsense mutation in the Xeroderma pigmentosum complementation group F (XPF) gene is associated with gastric carcinogenesis.
24318989 2014 Influence of ERCC1 and ERCC4 polymorphisms on response to prognosis in gastric cancer treated with FOLFOX-based chemotherapy.
24027083 2013 Evaluation of rare variants in the new fanconi anemia gene ERCC4 (FANCQ) as familial breast/ovarian cancer susceptibility alleles.
24004570 Inter-individual variation in nucleotide excision repair pathway is modulated by non-synonymous polymorphisms in ERCC4 and MBD4 genes.
23991957 2013 Xeroderma pigmentosum complementation group f polymorphisms influence risk of glioma.
23982883 2014 XPF protein levels determine sensitivity of malignant melanoma cells to oxaliplatin chemotherapy: suitability as a biomarker for patient selection.
23909490 2013 Polymorphisms in the ERCC1 and XPF genes and risk of breast cancer in a Chinese population.
23679285 2013 Effect of Xeroderma pigmentosum complementation group F polymorphisms on gastric cancer risk and associations with H.pylori infection.
23623389 2013 Malfunction of nuclease ERCC1-XPF results in diverse clinical manifestations and causes Cockayne syndrome, xeroderma pigmentosum, and Fanconi anemia.
23623386 2013 Mutations in ERCC4, encoding the DNA-repair endonuclease XPF, cause Fanconi anemia.
23580445 2013 Small molecule inhibitors of ERCC1-XPF protein-protein interaction synergize alkylating agents in cancer cells.
23537993 2013 Tagging SNPs in the ERCC4 gene are associated with gastric cancer risk.
23435956 2013 Decreased expression of DNA repair genes (XRCC1, ERCC1, ERCC2, and ERCC4) in squamous intraepithelial lesion and invasive squamous cell carcinoma of the cervix.
23415627 2013 Association of two ERCC4 tagSNPs with susceptibility to atrophic gastritis and gastric cancer in Chinese.
23385459 2013 Structure of the C-terminal half of human XPB helicase and the impact of the disease-causing mutation XP11BE.
22848636 2012 Association between single nucleotide polymorphisms in ERCC4 and risk of squamous cell carcinoma of the head and neck.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22771116 2012 XPG and XPF endonucleases trigger chromatin looping and DNA demethylation for accurate expression of activated genes.
22768293 2012 Association between XPF polymorphisms and cancer risk: a meta-analysis.
22609620 2012 Comparison of ERCC1/XPF genetic variation, mRNA and protein levels in women with advanced stage ovarian cancer treated with intraperitoneal platinum.
22547097 2012 Multiple DNA binding domains mediate the function of the ERCC1-XPF protein in nucleotide excision repair.
22457069 2012 Fluorescence-based incision assay for human XPF-ERCC1 activity identifies important elements of DNA junction recognition.
22353549 2012 Xeroderma pigmentosum group F protein binds to Eg5 and is required for proper mitosis: implications for XP-F and XFE.
22212909 2012 Deficiency of DNA repair nuclease ERCC1-XPF promotes prostate cancer progression in a tissue recombination model.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
21896658 2011 Human SNM1A and XPF-ERCC1 collaborate to initiate DNA interstrand cross-link repair.
21839691 2011 The knock-down of ERCC1 but not of XPF causes multinucleation.
21737503 2011 XPF expression correlates with clinical outcome in squamous cell carcinoma of the head and neck.
21672525 2011 MiR-192 inhibits nucleotide excision repair by targeting ERCC3 and ERCC4 in HepG2.2.15 cells.
21424776 2011 Lack of association between XPG Asp1104His and XPF Arg415Gln polymorphism and breast cancer risk: a meta-analysis of case-control studies.
21423097 2011 Polymorphisms of the DNA repair genes XRCC1 and ERCC4 are not associated with smoking- and drinking-dependent larynx cancer in a Polish population.
21277872 2011 XRCC1 and ERCC1 variants modify malignant mesothelioma risk: a case-control study.
21269460 2011 Initial characterization of the human central proteome.
20957144 2010 Interactions between exposure to environmental polycyclic aromatic hydrocarbons and DNA repair gene polymorphisms on bulky DNA adducts in human sperm.
20864414 2010 Polymorphisms of nucleotide-excision repair genes may contribute to sperm DNA fragmentation and male infertility.
20846399 2010 Cisplatin sensitivity of testis tumour cells is due to deficiency in interstrand-crosslink repair and low ERCC1-XPF expression.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20601096 2010 Single-nucleotide polymorphisms in DNA-repair genes and cutaneous melanoma.
20585324 2011 Genome-wide association study of conduct disorder symptomatology.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20518486 2010 The Fanconi anemia protein, FANCG, binds to the ERCC1-XPF endonuclease via its tetratricopeptide repeats and the central domain of ERCC1.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20429839 2010 Polymorphisms in DNA damage response genes and head and neck cancer risk.
20372803 2010 Metastases of squamous cell carcinoma of the head and neck show increased levels of nucleotide excision repair protein XPF in vivo that correlate with increased chemoresistance ex vivo.
20221251 2010 Mislocalization of XPF-ERCC1 nuclease contributes to reduced DNA repair in XP-F patients.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20199546 2010 Interactions between ultraviolet light exposure and DNA repair gene polymorphisms may increase melanoma risk.
20183911 2010 Synergistic effects of polymorphisms in DNA repair genes and endogenous estrogen exposure on female breast cancer risk.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20062074 2010 A novel XPF -357A>C polymorphism predicts risk and recurrence of bladder cancer.
20061190 2010 ERCC1 haplotypes modify bladder cancer risk: a case-control study.
19956886 2010 ERCC1 and XPF expression in human testicular germ cell tumors.
19920816 2009 Evaluation of a candidate breast cancer associated SNP in ERCC4 as a risk modifier in BRCA1 and BRCA2 mutation carriers. Results from the Consortium of Investigators of Modifiers of BRCA1/BRCA2 (CIMBA).
19902366 2010 Genetic variation in DNA repair genes and prostate cancer risk: results from a population-based study.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19596236 2009 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
19595722 2009 Drosophila MUS312 and the vertebrate ortholog BTBD12 interact with DNA structure-specific endonucleases in DNA repair and recombination.
19595721 2009 Coordination of structure-specific nucleases by human SLX4/BTBD12 is required for DNA repair.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19434073 2009 Common variations in ERCC2 are associated with response to cisplatin chemotherapy and clinical outcome in osteosarcoma patients.
19423537 2009 Five polymorphisms and breast cancer risk: results from the Breast Cancer Association Consortium.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19297315 2009 The NER proteins are differentially expressed in ever smokers and in never smokers with lung adenocarcinoma.
19258314 2009 The human oxidative DNA glycosylase NEIL1 excises psoralen-induced interstrand DNA cross-links in a three-stranded DNA structure.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124519 2009 DNA repair gene variants associated with benign breast disease in high cancer risk women.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19029193 2009 Red meat and poultry intake, polymorphisms in the nucleotide excision repair and mismatch repair pathways and colorectal cancer risk.
18990748 2008 International Lung Cancer Consortium: pooled analysis of sequence variants in DNA repair and cell cycle pathways.
18838045 2009 Inter-individual variation in nucleotide excision repair in young adults: effects of age, adiposity, micronutrient supplementation and genotype.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18812185 2008 Human XPF controls TRF2 and telomere length maintenance through distinctive mechanisms.
18767034 2008 Nucleotide excision repair polymorphisms may modify ionizing radiation-related breast cancer risk in US radiologic technologists.
18709642 2008 Nucleotide excision repair genes and risk of lung cancer among San Francisco Bay Area Latinos and African Americans.
18701435 2008 Polygenic model of DNA repair genetic polymorphisms in human breast cancer risk.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18551366 2009 Genetic variation in DNA repair pathway genes and premenopausal breast cancer risk.
18544627 2008 Polymorphisms in DNA repair genes, smoking, and pancreatic adenocarcinoma risk.
18396111 2008 ERCC1/XPF limits L1 retrotransposition.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18068852 2008 Polymorphisms in excision repair cross-complementing group 4 (ERCC4) and susceptibility to primary lung cancer in a Chinese Han population.
18026184 2008 NAT2 and NER genetic variants and sporadic prostate cancer susceptibility in African Americans.
18020456 2007 Deficiency in incisions produced by XPF at the site of a DNA interstrand cross-link in Fanconi anemia cells.
18006494 2008 Processing of a psoralen DNA interstrand cross-link by XPF-ERCC1 complex in vitro.
17945097 2007 [Influences of excision repair cross complementation group 4 genetic variations on DNA damage in lymphocytes among coke oven workers].
17912758 2008 The HhH domain of the human DNA repair protein XPF forms stable homodimers.
17685459 2007 Polymorphism in nucleotide excision repair gene XPC correlates with bleomycin-induced chromosomal aberrations.
17682675 2007 [Polymorphisms in XRCC1 and ERCC4/XPF DNA repair genes and associations with breast cancer risk in women].
17575242 2007 Nucleotide excision repair pathway genes and oral premalignant lesions.
17438655 Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers.
17313739 2006 [Association between nucleotide excision repair gene polymorphisms and chromosomal damage in coke-oven workers].
17299578 2007 Genetic polymorphisms in the nucleotide excision repair pathway and lung cancer risk: a meta-analysis.
17210993 2007 DNA repair gene polymorphisms and genetic predisposition to cutaneous melanoma.
17183314 2006 A new progeroid syndrome reveals that genotoxic stress suppresses the somatotroph axis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17078101 2006 Influence of polymorphisms in xenobiotic-metabolizing genes and DNA-repair genes on diepoxybutane-induced SCE frequency.
17055345 2007 XPF with mutations in its conserved nuclease domain is defective in DNA repair but functions in TRF2-mediated telomere shortening.
17018596 2006 ERCC4 associated with breast cancer risk: a two-stage case-control study using high-throughput genotyping.
16823510 2007 Breast cancer risk is not associated with polymorphic forms of xeroderma pigmentosum genes in a cohort of women from Washington County, Maryland.
16806697 2006 Polymorphisms in the DNA repair genes XPD (ERCC2) and XPF (ERCC4) are not associated with sporadic late-onset Alzheimer's disease.
16678501 2006 gamma-H2AX formation in response to interstrand crosslinks requires XPF in human cells.
16638864 2006 Association of DNA repair and steroid metabolism gene polymorphisms with clinical late toxicity in patients treated with conformal radiotherapy for prostate cancer.
16609022 2006 Polymorphisms in genes of nucleotide and base excision repair: risk and prognosis of colorectal cancer.
16537713 2006 Genetic variation in the nucleotide excision repair pathway and bladder cancer risk.
16492920 2006 Nucleotide excision repair gene polymorphisms and risk of advanced colorectal adenoma: XPC polymorphisms modify smoking-related risk.
16399771 2006 Polymorphisms in nucleotide excision repair genes, smoking and breast cancer in African Americans and whites: a population-based case-control study.
16393248 2006 Gene-environment interaction involved in oral carcinogenesis: molecular epidemiological study for metabolic and DNA repair gene polymorphisms.
16338413 2005 The structure of the human ERCC1/XPF interaction domains reveals a complementary role for the two proteins in nucleotide excision repair.
16284380 2005 Polymorphisms/haplotypes in DNA repair genes and smoking: a bladder cancer case-control study.
16284373 2005 Interindividual variation in nucleotide excision repair genes and risk of endometrial cancer.
16258177 2006 Polymorphisms in nucleotide excision repair genes and risk of multiple primary melanoma: the Genes Environment and Melanoma Study.
16195237 2006 Polymorphisms of DNA repair genes and risk of non-small cell lung cancer.
16076955 2005 Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1.
16034668 2005 Resonance assignments for the DNA binding domain of ERCC-1/XPF heterodimer.
15936543 2005 Gastrostomy in oropharyngeal cancer patients with ERCC4 (XPF) germline variants.
15932882 2005 Biophysical characterization of the interaction domains and mapping of the contact residues in the XPF-ERCC1 complex.
15886521 2005 Obesity and genetic polymorphism of ERCC2 and ERCC4 as modifiers of risk of breast cancer.
15849729 2005 Polymorphisms in the DNA nucleotide excision repair genes and lung cancer risk in Xuan Wei, China.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184880 2004 Disruption of the Rad9/Rad1/Hus1 (9-1-1) complex leads to checkpoint signaling and replication defects.
15095299 2004 Reduced levels of XPA, ERCC1 and XPF DNA repair proteins in testis tumor cell lines.
14734547 2004 Physical and functional interaction between the XPF/ERCC1 endonuclease and hRad52.
14728600 2004 Defining the function of xeroderma pigmentosum group F protein in psoralen interstrand cross-link-mediated DNA repair and mutagenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690602 2003 ERCC1/XPF removes the 3' overhang from uncapped telomeres and represses formation of telomeric DNA-containing double minute chromosomes.
14652281 2003 DNA-repair genetic polymorphisms and breast cancer risk.
14625810 2003 Variable continental distribution of polymorphisms in the coding regions of DNA-repair genes.
12571280 2003 Nonerythroid alphaII spectrin is required for recruitment of FANCA and XPF to nuclear foci induced by DNA interstrand cross-links.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11895912 2002 Polymorphisms in genes encoding drugs and xenobiotic metabolizing enzymes, DNA repair enzymes, and response to treatment of childhood acute lymphoblastic leukemia.
11790111 2002 Contribution of XPF functional domains to the 5' and 3' incisions produced at the site of a psoralen interstrand cross-link.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11259578 2001 Strong functional interactions of TFIIH with XPC and XPG in human DNA nucleotide excision repair, without a preassembled repairosome.
10644440 1999 Characterization of the mouse Xpf DNA repair gene and differential expression during spermatogenesis.
10583946 1999 Quality control by DNA repair.
10479728 1999 Polymorphisms in the human DNA repair gene XPF.
10447254 1999 A summary of mutations in the UV-sensitive disorders: xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy.
10413517 1999 Domain mapping of the DNA binding, endonuclease, and ERCC1 binding properties of the human DNA repair protein XPF.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10074455 1999 Defective repair of cisplatin-induced DNA damage caused by reduced XPA protein in testicular germ cell tumours.
9722633 1998 Mapping of interaction domains between human repair proteins ERCC1 and XPF.
9580660 1998 Characterization of molecular defects in xeroderma pigmentosum group F in relation to its clinically mild symptoms.
9579555 1998 Homozygous R788W point mutation in the XPF gene of a patient with xeroderma pigmentosum and late-onset neurologic disease.
9485007 1998 Nonconservative amino acid substitution variants exist at polymorphic frequency in DNA repair genes in healthy humans.
8887684 1996 ERCC4 (XPF) encodes a human nucleotide excision repair protein with eukaryotic recombination homologs.
8797827 1996 Xeroderma pigmentosum group F caused by a defect in a structure-specific DNA repair endonuclease.
8332082 1993 Regional mapping of human DNA excision repair gene ERCC4 to chromosome 16p13.13-p13.2.
8197175 1994 Formation of a ternary complex by human XPA, ERCC1, and ERCC4(XPF) excision repair proteins.
7559382 1995 Purification and characterization of the XPF-ERCC1 complex of human DNA repair excision nuclease.