Property Summary

NCBI Gene PubMed Count 173
Grant Count 129
R01 Count 75
Funding $8,797,766.67
PubMed Score 252.46
PubTator Score 213.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.100 0.002
hepatocellular carcinoma 1.600 0.000
pancreatic cancer 1.100 0.006
psoriasis 1.400 0.001
osteosarcoma 2.161 0.000
glioblastoma 1.100 0.001
medulloblastoma, large-cell 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.369 0.005
diabetes mellitus -1.100 0.006
posterior fossa group B ependymoma 1.100 0.000
pancreatic carcinoma 1.100 0.006

Synonym

Accession Q92889 A5PKV6 A8K111 O00140 Q8TD83
Symbols XPF
RAD1
FANCQ
XFEPS
ERCC11

Gene

PDB

1Z00   2A1J   2AQ0   2KN7   2MUT  

Gene RIF (156)

PMID Text
26453996 SLX4 (FANCP) and XPF (FANCQ) proteins interact with each other and play a vital role in the Fanconi anemia (FA) DNA repair pathway.
26411687 Helicobacter Pylori introduces double-stranded DNA breaks by the nucleotide excision repair endonucleases XPF and XPG, which, together with RelA, are recruited to chromatin in a highly coordinated, type IV secretion system-dependent manner.
26085086 F231L mutation results in only a small disturbance of the ERCC1-XPF interface, where, in contrast to Phe(231), Leu(231) lacks interactions stabilizing the ERCC1-XPF complex
26074087 ERCC4 is located on human chromosome 16p13.12 and consists of 11 exons spanning about 28.2 kb, the broad tissue expression pattern of ERCC4 is similar to that of ERCC1; ERCC1 and ERCC4 genes encode the two subunits of the ERCC1-XPF nuclease. This enzyme plays an important role in repair of DNA damage and in maintaining genomic stability. [Review]
26045829 Genotypes of ERCC1 (rs11615, rs3212986 and rs2298881) and XPF (rs2276465 and rs6498486) were performed by Polymerase Chain Reaction Restriction Fragment Length Polymorphism (PCR-RFLP) assay
26025908 ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex. ERCC1-XPF and RPA form a DNA/protein complex on the nick DNA substrate.
25879486 Mus81-deficient cells fail to recover from exposure to low doses of replication inhibitors and cell viability is dependent on the XPF endonuclease.
25730007 we found no association between the rs11615 of the ERCC1 and rs2276466 of the XPF polymorphisms and the risk of colorectal cancer
25538220 these results establish USP45 as a new regulator of XPF-ERCC1 crucial for efficient DNA repair
25535740 XPF and XPC expression may be a potential predictive factor for bladder cancer, and smoking can not only influence the recurrence of bladder cancer as a single factor but also aggravate the results of the XPF defect and XPC defect.
More...

AA Sequence

MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVLVLNTQPAEEE      1 - 70
YFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLTDRIPSDLITGILVYRAHRII     71 - 140
ESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVERVMRNLFVRKLYLWPRFHVAVNSFLEQHKPE    141 - 210
VVEIHVSMTPTMLAIQTAILDILNACLKELKCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAK    211 - 280
TKSLVQDLKILRTLLQYLSQYDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAK    281 - 350
MSKKEKISEKMEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQL    351 - 420
RDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERASTKERTLKKKKR    421 - 490
KLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSSDAAFGILKEPLTIIHPLLGC    491 - 560
SDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPGKPLRVYFLIYGGSTEEQRYLTALRKEKEAF    561 - 630
EKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIH    631 - 700
RRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLT    701 - 770
SRGALFQEISSNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPE    771 - 840
SEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVS    841 - 910
KGKGKK                                                                    911 - 916
//

Text Mined References (179)

PMID Year Title
26453996 2015 Physical interaction between SLX4 (FANCP) and XPF (FANCQ) proteins and biological consequences of interaction-defective missense mutations.
26411687 2015 H. pylori-Induced DNA Strand Breaks Are Introduced by Nucleotide Excision Repair Endonucleases and Promote NF-?B Target Gene Expression.
26085086 2015 The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
26074087 2015 The ERCC1 and ERCC4 (XPF) genes and gene products.
26045829 2015 Polymorphisms in ERCC1 and XPF gene and response to chemotherapy and overall survival of non-small cell lung cancer.
26025908 2015 Repair synthesis step involving ERCC1-XPF participates in DNA repair of the Top1-DNA damage complex.
25879486 2015 The DNA repair endonuclease Mus81 facilitates fast DNA replication in the absence of exogenous damage.
25730007 2015 Association between ERCC1 and XPF polymorphisms and risk of colorectal cancer.
25538220 2015 USP45 deubiquitylase controls ERCC1-XPF endonuclease-mediated DNA damage responses.
25535740 2014 Attenuated NER expressions of XPF and XPC associated with smoking are involved in the recurrence of bladder cancer.
More...