Property Summary

NCBI Gene PubMed Count 49
Grant Count 230
R01 Count 112
Funding $38,523,121.36
PubMed Score 765.39
PubTator Score 42.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.257 0.000
ovarian cancer -2.000 0.000

Synonym

Accession Q92888 O00513 Q6NX52 Q8N4J4 Q96BF4 Q96F17 Q9BSB1
Symbols LSC
GEF1
LBCL2
SUB1.5
P115-RHOGEF

Gene

PDB

1IAP   1SHZ   3AB3   3ODO   3ODW   3ODX   3P6A  

Gene RIF (27)

PMID Text
25916117 contactin-1 displayed the ability to phosphorylate the RhoA activator p115 RhoGEF
24855647 Regulated localization is sufficient for hormonal control of regulator of G protein signaling homology Rho guanine nucleotide exchange factors (RH-RhoGEFs).
24465552 The novel role for p115RhoGEF in regulation of epithelial plasticity is dependent on Rho-DRF signaling module.
23816534 Modification of p115RhoGEF at Serine(330) regulates its RhoGEF activity.
23718289 The action of DOCK7 in vivo may involve the coordinated integration of Cdc42/Rac1 signaling in the context of the membrane recruitment of a DOCK7 guanine nucleotide exchange factor (GEF) complex.
23705972 The interaction of the long cytoplasmic tail of HIV-1 gp41 with the carboxy-terminal regulatory domain of p115-RhoGEF inhibits p115-mediated actin stress fiber formation and activation of serum response factor (SRF)
23077317 The interaction of the long cytoplasmic tail of HIV-1 gp41 with the carboxy-terminal regulatory domain of p115-RhoGEF inhibits p115-mediated actin stress fiber formation and activation of serum response factor (SRF)
23070684 High GEF1 expression is associated with metastasis of pancreatic cancer.
22661716 Activation of p115-RhoGEF requires direct association of Galpha13 and the Dbl homology domain.
22500016 Upon beta(2)AR activation, both betaArrestin2 and p115RhoGEF translocate to the plasma membrane, with concomitant activation of RhoA and formation of focal adhesions and stress fibers.
More...

AA Sequence

MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLMALLQHVALQF      1 - 70
EPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAFELDRTRADLISEDVQRRFVQ     71 - 140
EVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTIST    141 - 210
DEEKSAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQ    211 - 280
VPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSS    281 - 350
PQGPMSLESLAPPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV    351 - 420
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIE    421 - 490
EIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPT    491 - 560
EMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQS    561 - 630
SDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDG    631 - 700
KTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASR    701 - 770
PKPRPSPSSTREPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP    771 - 840
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPG    841 - 910
CT                                                                        911 - 912
//

Text Mined References (60)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25916117 [Under hypoxia condition contactin-1 regulates migration of MKN45 cells through RhoA pathway].
25416956 2014 A proteome-scale map of the human interactome network.
24855647 2014 Regulated localization is sufficient for hormonal control of regulator of G protein signaling homology Rho guanine nucleotide exchange factors (RH-RhoGEFs).
24465552 2014 A novel role for p115RhoGEF in regulation of epithelial plasticity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23816534 2013 Modification of p115RhoGEF Ser(330) regulates its RhoGEF activity.
23718289 2013 Prenylation and membrane localization of Cdc42 are essential for activation by DOCK7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23070684 2012 miR-143 inhibits the metastasis of pancreatic cancer and an associated signaling pathway.
More...