Property Summary

NCBI Gene PubMed Count 21
PubMed Score 132.51
PubTator Score 63.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 3.300 6.8e-08
medulloblastoma, large-cell 2.600 1.8e-03

 GO Component (2)

Gene RIF (15)

AA Sequence

MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQE      1 - 70
RRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNY     71 - 140
IWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDAESWGSGAAAASPLSDPSSPAASEDFTY    141 - 210
RPGDPVFSFPSLPKDLLHTTPCFIPYH                                               211 - 237
//

Text Mined References (21)

PMID Year Title