1. Home
  2. Targets
  3. transcription factor
  4. nuclease
  5. Neurogenin-1

Tbio Neurogenin-1

Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcriptional regulators of neurogenesis (By similarity).

 Comments

Property Summary

NCBI Gene PubMed Count 19
Grant Count 86
R01 Count 66
Funding $9,083,639.34
PubMed Score 123.59
PubTator Score 63.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Disease Z-score Confidence
Colorectal Cancer 47 4.173 2.1
Cerebellar liponeurocytoma 2 3.166 1.6
group 4 medulloblastoma 1,875
medulloblastoma, large-cell 6,234

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 4.200 0.000
medulloblastoma, large-cell 2.600 0.002

Synonym

Accession Q92886 Q5U0Q9 Q96HE1 NGN-1
Symbols AKA
ngn1
Math4C
bHLHa6
NEUROD3

Gene

NEUROG1

PANTHER Protein Class (2)

 Grant Application (86)

See all...

 GO Function (5)

 GO Component (2)

 GO Process (10)

 Compartment GO Term (10)

 MGI Term (4)

Pathway (4)

 UniProt Keyword (10)

Gene RIF (13)

PMID Text
25403753 Results show that neurogenin-1 and -2 drive homogeneous differentiation of human stem cells into bipolar neurons in 4 days in defined media.
23419067 We propose NEUROG1 as a new gene for syndromic autosomal recessive hearing loss and congenital cranial dysinnervation disorder
23034738 Methylation of NEUROG1 is associated with recurrence following adjuvant FOLFOX in Stages II/III colorectal cancer.
21326223 NEUROG1 gene is frequently found in patients, diagnosed with colorectal cancer.
20102160 The basic helix-loop-helix region of human neurogenin 1 is a monomeric natively unfolded protein which forms a "fuzzy" complex upon DNA binding.
19813087 Stable expression of a single gene Ngn1 in F3 cells induces not simply neurogenic but multifunctional changes that potentially affect the differentiation of human NSC via a reorganization of complex gene regulatory networks.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18799289 Major alleles on two NEUROG1-associated SNPs (rs2344484-C-allele and rs8192558-G-allele) were significantly more prevalent among patients. this is the first study to examine brain morphological and neurocognitive correlates of NEUROG1.
18799289 Observational study of gene-disease association. (HuGE Navigator)
18053270 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence 

MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQE      1 - 70
RRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNY     71 - 140
IWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDAESWGSGAAAASPLSDPSSPAASEDFTY    141 - 210
RPGDPVFSFPSLPKDLLHTTPCFIPYH                                               211 - 237
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25403753 2014 Rapid neurogenesis through transcriptional activation in human stem cells.
23419067 2013 A boy with homozygous microdeletion of NEUROG1 presents with a congenital cranial dysinnervation disorder [Moebius syndrome variant].
23034738 2013 Methylation and microsatellite status and recurrence following adjuvant FOLFOX in colorectal cancer.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21326223 2011 Methylation of NEUROG1 in serum is a sensitive marker for the detection of early colorectal cancer.
20102160 2010 The basic helix-loop-helix region of human neurogenin 1 is a monomeric natively unfolded protein which forms a "fuzzy" complex upon DNA binding.
19813087 2010 Stable expression of neurogenin 1 induces LGR5, a novel stem cell marker, in an immortalized human neural stem cell line HB1.F3.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18799289 2008 Basic helix-loop-helix transcription factor NEUROG1 and schizophrenia: effects on illness susceptibility, MRI brain morphometry and cognitive abilities.
More...