Property Summary

NCBI Gene PubMed Count 25
PubMed Score 40.56
PubTator Score 80.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
astrocytic glioma -1.700 0.026
oligodendroglioma -1.900 0.018
esophageal adenocarcinoma -1.400 0.024
psoriasis 1.300 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.600 0.001
lung cancer -1.500 0.000
diabetes mellitus -1.100 0.020
adult high grade glioma -1.300 0.008
ovarian cancer 1.800 0.000

Gene RIF (7)

PMID Text
21501342 Data show that SH3P2 was phosphorylated on Ser(202) by ribosomal S6 kinase (RSK) in an ERK pathway-dependent manner, and such phosphorylation inhibited the ability of SH3P2 to suppress cell motility.
20424473 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19137598 The peptide-binding groove of OSTF-SH3 domain adopts a conformation different from other SH3 domains and probably needs a conformational switch for binding to its proline-rich ligand; this status is possibly regulated by the C-terminal ankyrin repeats.
16946461 The SH3 domain structure of osteoclast stimulating factor at atomic resolution provides an accurate framework for structure-based design of its inhibitors.
16508112 Crystals of human osteoclast-stimulating factor were obtained by the hanging-drop vapour-diffusion method using X ray crystallography.
15135048 SH3P2, a novel component of adhesion sites, is involved in Cbl and Src-mediated pathways

AA Sequence

MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQA      1 - 70
ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG     71 - 140
DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDYLDD    141 - 210
EDSD                                                                      211 - 214
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21501342 2011 SH3P2 is a negative regulator of cell motility whose function is inhibited by ribosomal S6 kinase-mediated phosphorylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...