Property Summary

NCBI Gene PubMed Count 26
PubMed Score 62.33
PubTator Score 80.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.300 8.2e-03
astrocytic glioma -1.700 2.6e-02
atypical teratoid / rhabdoid tumor -2.300 1.0e-07
diabetes mellitus -1.100 2.0e-02
esophageal adenocarcinoma -1.400 2.4e-02
glioblastoma -1.500 2.3e-05
group 4 medulloblastoma -1.900 2.5e-04
lung cancer -1.500 3.2e-04
malignant mesothelioma -2.000 7.1e-08
medulloblastoma, large-cell -3.000 1.0e-07
oligodendroglioma -1.900 1.8e-02
ovarian cancer 1.800 2.3e-05
primitive neuroectodermal tumor -1.600 5.0e-04
psoriasis 1.300 3.1e-04

Gene RIF (7)

AA Sequence

MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQA      1 - 70
ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG     71 - 140
DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDYLDD    141 - 210
EDSD                                                                      211 - 214
//

Text Mined References (37)

PMID Year Title