Property Summary

NCBI Gene PubMed Count 25
PubMed Score 40.56
PubTator Score 80.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 7.1302124803484E-8
atypical teratoid / rhabdoid tumor 4369 1.00588606726043E-7
medulloblastoma, large-cell 6234 1.02962131350131E-7
ovarian cancer 8492 2.27453913751407E-5
glioblastoma 5572 2.3292919347272E-5
medulloblastoma 1524 1.68682191394505E-4
psoriasis 6685 3.08221663911034E-4
lung cancer 4473 3.22299334764037E-4
primitive neuroectodermal tumor 3031 5.00777615987436E-4
adult high grade glioma 2148 0.00819962814763411
oligodendroglioma 2849 0.0181426204967597
diabetes mellitus 1663 0.019848725398447
esophageal adenocarcinoma 737 0.0238618981609131
astrocytic glioma 2241 0.0255848478561976

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
astrocytic glioma -1.700 0.026
oligodendroglioma -1.900 0.018
esophageal adenocarcinoma -1.400 0.024
psoriasis 1.300 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.600 0.001
lung cancer -1.500 0.000
diabetes mellitus -1.100 0.020
adult high grade glioma -1.300 0.008
ovarian cancer 1.800 0.000

Synonym

Accession Q92882 Q5W126 Q96IJ4
Symbols OSF
SH3P2
bA235O14.1

Gene

PDB

1X2K   1ZLM   3EHQ   3EHR  

  Ortholog (14)

Gene RIF (7)

PMID Text
21501342 Data show that SH3P2 was phosphorylated on Ser(202) by ribosomal S6 kinase (RSK) in an ERK pathway-dependent manner, and such phosphorylation inhibited the ability of SH3P2 to suppress cell motility.
20424473 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19137598 The peptide-binding groove of OSTF-SH3 domain adopts a conformation different from other SH3 domains and probably needs a conformational switch for binding to its proline-rich ligand; this status is possibly regulated by the C-terminal ankyrin repeats.
16946461 The SH3 domain structure of osteoclast stimulating factor at atomic resolution provides an accurate framework for structure-based design of its inhibitors.
16508112 Crystals of human osteoclast-stimulating factor were obtained by the hanging-drop vapour-diffusion method using X ray crystallography.
15135048 SH3P2, a novel component of adhesion sites, is involved in Cbl and Src-mediated pathways

AA Sequence

MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQA      1 - 70
ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG     71 - 140
DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDYLDD    141 - 210
EDSD                                                                      211 - 214
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21501342 2011 SH3P2 is a negative regulator of cell motility whose function is inhibited by ribosomal S6 kinase-mediated phosphorylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...