Property Summary

NCBI Gene PubMed Count 74
Grant Count 197
R01 Count 146
Funding $18,528,006.68
PubMed Score 137.11
PubTator Score 100.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92879 B4E2U5 D3DQS0 F8W940 Q4LE52 Q9NP83 Q9NR06 CELF-1
Symbols CUGBP
NAB50
NAPOR
CUG-BP
CUGBP1
hNab50
BRUNOL2
EDEN-BP

Gene

PDB

2CPZ   2DHS   2RQ4   2RQC   3NMR   3NNA   3NNC   3NNH  

Gene RIF (48)

PMID Text
26919393 Expression of several genes within the CELF1 locus, including MTCH2, were highly correlated with one another and were associated with Alzheimer's disease status.
26728670 High expression of CUGBP1 is associated with recurrence in lung adenocarcinoma.
26531141 CUG-BP1 affected the calcium release activity in single myofibers and the extent of atrophy was significantly reduced upon gene silencing of CUG-BP1 in atrophic muscle.
26498364 these data provided a comprehensive view of the CELF1 mRNA regulatory network in oral cancer
26491048 CUGBP1 and HuR negate each other's effects in regulating E-cadherin translation by altering the recruitment of E-cadherin mRNA to PBs and play important roles in the regulation of intestinal barrier integrity.
26249002 CELF1 dysfunction in malignant T cells led to the up-regulation of a subset of GRE-containing transcripts that promote cell growth and down-regulation of another subset that suppress cell growth
26234674 forced expression of miR-214-3p enhances the sensitivity of esophageal cancer cells to cisplatin-induced apoptosis. This effect is abrogated with rescue expression of survivin or CUG-BP1
26164657 Celf1 has a role in vegetal RNA localization during Xenopus oogenesis
26130707 The results indicate that the cellular level of miR-122 is determined by the balance between the opposing effects of GLD-2 and PARN/CUGBP1 on the metabolism of its 3'-terminus.
25701464 CUGBP1 promotes cell proliferation and suppresses apoptosis via down-regulating C-EBPalpha in human non-small cell lung cancers.
More...

AA Sequence

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK      1 - 70
AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL     71 - 140
RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA    141 - 210
ASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSG    211 - 280
TNALTTSSSPLSVLTSSGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSN    281 - 350
GTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQM    351 - 420
FMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY        421 - 486
//

Text Mined References (82)

PMID Year Title
26919393 2016 Alzheimer's Disease Risk Polymorphisms Regulate Gene Expression in the ZCWPW1 and the CELF1 Loci.
26728670 2015 Prognostic impact of CUG-binding protein 1 expression and vascular invasion after radical surgery for stage IB nonsmall cell lung cancer.
26531141 2015 CUG-BP1 regulates RyR1 ASI alternative splicing in skeletal muscle atrophy.
26498364 2015 RNA-binding protein CELF1 promotes tumor growth and alters gene expression in oral squamous cell carcinoma.
26491048 2016 CUGBP1 and HuR regulate E-cadherin translation by altering recruitment of E-cadherin mRNA to processing bodies and modulate epithelial barrier function.
26249002 2015 Altered CELF1 binding to target transcripts in malignant T cells.
26234674 2016 Overexpression of miR-214-3p in esophageal squamous cancer cells enhances sensitivity to cisplatin by targeting survivin directly and indirectly through CUG-BP1.
26164657 2015 A novel role for Celf1 in vegetal RNA localization during Xenopus oogenesis.
26130707 2015 Destabilization of microRNAs in human cells by 3' deadenylation mediated by PARN and CUGBP1.
25701464 2015 CUGBP1 promotes cell proliferation and suppresses apoptosis via down-regulating C/EBP? in human non-small cell lung cancers.
More...