Property Summary

NCBI Gene PubMed Count 79
PubMed Score 146.59
PubTator Score 100.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
aldosterone-producing adenoma -1.007 1.1e-02
astrocytoma 1.100 1.3e-02
atypical teratoid / rhabdoid tumor 1.100 1.8e-03
ependymoma 1.200 1.7e-02
group 3 medulloblastoma 1.100 3.5e-02
intraductal papillary-mucinous carcinoma... 1.100 1.3e-03
medulloblastoma, large-cell 1.400 1.0e-03
Multiple myeloma 1.428 5.4e-03
oligodendroglioma 1.300 5.4e-03
osteosarcoma 1.287 3.4e-05
ovarian cancer -1.700 8.7e-07
pancreatic ductal adenocarcinoma liver m... 1.307 5.5e-03
primitive neuroectodermal tumor 1.300 8.7e-03
psoriasis -3.400 5.2e-06
spina bifida -1.115 3.5e-02
subependymal giant cell astrocytoma -1.451 2.6e-02
Waldenstrons macroglobulinemia 1.300 4.5e-03

Gene RIF (53)

AA Sequence

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK      1 - 70
AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL     71 - 140
RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA    141 - 210
ASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSG    211 - 280
TNALTTSSSPLSVLTSSGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSN    281 - 350
GTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQM    351 - 420
FMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY        421 - 486
//

Text Mined References (89)

PMID Year Title