Property Summary

NCBI Gene PubMed Count 162
Grant Count 28
R01 Count 27
Funding $1,394,135.06
PubMed Score 22.78
PubTator Score 220.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma -1.173 0.005
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma -1.300 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.001
intraductal papillary-mucinous carcinoma... 1.400 0.002
lung cancer 1.200 0.034
Pick disease -1.300 0.000
progressive supranuclear palsy -1.500 0.006
ovarian cancer 1.300 0.003

Gene RIF (120)

PMID Text
27016230 study identified the copy number deletion of RAD50 as a candidate marker for survival
26493291 The C allele of rs6871536 was positively associated with atopic asthma in a Chinese population.
26366868 a significant increase in DKC1, RAD50, MRE11 and RPA1 expression in MM cases with high bone marrow infiltration (p</=0.03) and a tendency towards cases with advanced ISS stage
26365633 Lack of association between RAD50-IL13 polymorphisms and pediatric asthma susceptibility in Northeastern Han Chinese
26310047 The results did not confirm the previously reported association between the RAD50 SNP Rs2237060 and the development of either common variable immunodeficiency or selective IgA deficiency.
26068589 The MRN complex is essential to restrain MYCN-induced replication stress during neural cell proliferation.
26014697 SNP (rs17166050) in RAD50 gene is associated with the susceptibility to acute lymphoid leukemia in children
25903339 This work demonstrates that the Mre11-Rad50-Nbs1 DNA repair complex positively regulates AAV replication and plays a role in the integration of adeno-associated airus in the presence of herpes simplex virus 1.
25828805 These results suggest that MRE11 is important in maintaining the structural arrangement of RAD50 in the protein complex and perhaps has a role in reinforcing proper alignment of the coiled coils in the ATP-bound state.
25576492 Furthermore, they collectively help to explain how MRN regulates DNA repair pathway choice. [review]
More...

AA Sequence

MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDP      1 - 70
KVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREM     71 - 140
ISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMEL    141 - 210
KYLKQYKEKACEIRDQITSKEAQLTSSKEIVKSYENELDPLKNRLKEIEHNLSKIMKLDNEIKALDSRKK    211 - 280
QMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQ    281 - 350
GRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAE    351 - 420
KETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQLEGSSDRILELDQELIKAERELSK    421 - 490
AEKNSNVETLKMEVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEMLTKDKADKDEQIRKIKSRHS    491 - 560
DELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKELASSEQNKNHINNELKRKEEQLSSYEDKLF    561 - 630
DVCGSQDFESDLDRLKEEIEKSSKQRAMLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISD    631 - 700
LQSKLRLAPDKLKSTESELKKKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEE    701 - 770
QETLLGTIMPEEESAKVCLTDVTIMERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLD    771 - 840
TVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQLEEQTVELSTEVQSLYREIKDAKE    841 - 910
QVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNIHGYMKDIENYIQDGKDDYKKQKETEL    911 - 980
NKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQDNLTLRKRNEELKEVEEERKQHLKEMGQMQV    981 - 1050
LQMKSEHQKLEENIDNIKRNHNLALGRQKGYEEEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKD   1051 - 1120
LDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLK   1121 - 1190
GDTALDMRGRCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRSQQR   1191 - 1260
NFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH                     1261 - 1312
//

Text Mined References (173)

PMID Year Title
27568553 2016 MRNIP/C5orf45 Interacts with the MRN Complex and Contributes to the DNA Damage Response.
27016230 2016 Copy number deletion of RAD50 as predictive marker of BRCAness and PARP inhibitor response in BRCA wild type ovarian cancer.
26493291 2015 Polymorphisms of RAD50, IL33 and IL1RL1 are associated with atopic asthma in Chinese population.
26366868 2015 Differential Expression of Non-Shelterin Genes Associated with High Telomerase Levels and Telomere Shortening in Plasma Cell Disorders.
26365633 2016 Lack of association between RAD50-IL13 polymorphisms and pediatric asthma susceptibility in Northeastern Han Chinese.
26310047 2015 RAD50 Single-Nucleotide Polymorphism in Predominantly Antibody Deficiency.
26068589 2016 The MRN complex is transcriptionally regulated by MYCN during neural cell proliferation to control replication stress.
26014697 2015 [Association between polymorphism of RAD50 gene and acute lymphoid leukemia in children].
25903339 2015 Impact of the MRN Complex on Adeno-Associated Virus Integration and Replication during Coinfection with Herpes Simplex Virus 1.
25828805 2015 Human RAD50 makes a functional DNA-binding complex.
More...