Property Summary

NCBI Gene PubMed Count 92
PubMed Score 151.45
PubTator Score 142.89

Knowledge Summary


No data available


  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.700 4.4e-02
Astrocytoma, Pilocytic -1.300 2.7e-02
atypical teratoid / rhabdoid tumor -1.100 2.6e-02
Breast cancer -1.800 5.9e-08
cutaneous lupus erythematosus 3.300 1.4e-03
cystic fibrosis 1.600 2.3e-03
ependymoma -2.300 2.2e-02
group 3 medulloblastoma -2.400 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-02
lung adenocarcinoma 1.100 2.9e-05
lung cancer 1.200 7.1e-04
non-small cell lung cancer 1.203 2.4e-06
oligodendroglioma -1.200 7.3e-06
ovarian cancer 3.100 8.2e-07
pancreatic cancer 1.600 5.5e-03
pediatric high grade glioma -1.600 7.9e-03
Pick disease -1.300 1.8e-02
progressive supranuclear palsy -1.500 1.4e-02
psoriasis 3.400 3.6e-06
spina bifida -1.000 1.2e-02
subependymal giant cell astrocytoma -4.242 1.6e-03

Gene RIF (72)

AA Sequence

VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK                                        211 - 244

Text Mined References (99)

PMID Year Title