Property Summary

NCBI Gene PubMed Count 86
PubMed Score 143.92
PubTator Score 142.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 5.88870061335808E-8
ovarian cancer 8492 8.17083634674423E-7
non-small cell lung cancer 2798 2.35695945983789E-6
oligodendroglioma 2849 7.31105575582055E-6
lung adenocarcinoma 2714 2.94162235772262E-5
atypical teratoid/rhabdoid tumor 1095 3.50053437668254E-4
lung cancer 4473 7.07517720410595E-4
psoriasis 6685 0.00110455401250324
cutaneous lupus erythematosus 1056 0.00140384453570014
subependymal giant cell astrocytoma 2287 0.00160935960134723
cystic fibrosis 1670 0.00226296193893663
pancreatic cancer 2300 0.00551082287383977
pediatric high grade glioma 2712 0.00786887766737425
spina bifida 1064 0.0119637101797698
progressive supranuclear palsy 674 0.0144922985222266
Pick disease 1893 0.0176368101991335
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0178222064558399
ependymoma 2514 0.0221855380412197
pilocytic astrocytoma 3086 0.0259614057279143
group 3 medulloblastoma 2254 0.0279816516506849
active ulcerative colitis 477 0.0444088735393673

Expression

  Differential Expression (21)

Disease log2 FC p
ependymoma -2.300 0.022
psoriasis 3.800 0.001
cutaneous lupus erythematosus 3.300 0.001
oligodendroglioma -1.200 0.000
group 3 medulloblastoma -2.400 0.028
atypical teratoid/rhabdoid tumor -1.900 0.000
non-small cell lung cancer 1.203 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.018
lung cancer 1.200 0.001
active ulcerative colitis 1.700 0.044
pancreatic cancer 1.600 0.006
cystic fibrosis 1.600 0.002
lung adenocarcinoma 1.100 0.000
pediatric high grade glioma -1.600 0.008
pilocytic astrocytoma -1.400 0.026
subependymal giant cell astrocytoma -4.242 0.002
spina bifida -1.000 0.012
Pick disease -1.300 0.018
progressive supranuclear palsy -1.500 0.014
Breast cancer -1.800 0.000
ovarian cancer 3.100 0.000

Synonym

Accession Q92876 A6NJA1 A8MW09 Q6H301
Symbols hK6
Bssp
Klk7
SP59
PRSS9
PRSS18

Gene

PANTHER Protein Class (3)

PDB

1GVL   1L2E   1LO6   3VFE   4D8N  

  Ortholog (7)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (67)

PMID Text
26231762 Data demonstrate that elevated levels of KLK6, KLK7 and KLK9 proteins are associated with poor glioblastoma patients survival.
26172508 Data indicate that elevated expression of microRNA-375 in head and neck squamous cell carcinoma (HNSCC) cells significantly reduces kallikrein 6 (KLK6), kallikrein 10 (KLK10), and matrix metalloproteinase 9 (MMP9) messenger RNA expression.
25990935 KLK6 expression was detected in head and neck tumor cell lines (FaDu, Cal27 and SCC25), but not in HeLa cervix carcinoma cells.
25649006 KLK6 and KLK10 may be useful markers and potential therapeutic targets in gastroesophageal junction tumors
25477184 KLK6 and KLK7 mRNA and protein overexpression is directly associated with early-stage ovarian tumors.
25476568 The results of this study indicated that reductions in kallikrein-6 and calpain-1 may contribute to the accumulation of alpha-synuclein in DLB.
25153391 KLK6 may represent a potential unfavorable prognostic biomarker for colon cancer.
25153389 This study assessed the prognostic utility of human tissue kallikrein-like peptidases 6 and 10 (KLK6 and KLK10) and correlated their expression with histopathological and clinical parameters in gastric cancer.
24979321 Our data suggest that de novo KLK6 expression during early liver carcinogenesis may induce production of Ubi(1-74) by post-translational modification of ubiquitin
24669031 The level of KLK6 is significantly increased in the plasma samples from laryngeal cancer patients compared to the controls.
More...

AA Sequence

MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV      1 - 70
FLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHI     71 - 140
LGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGL    141 - 210
VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK                                        211 - 244
//

Text Mined References (93)

PMID Year Title
26231762 2015 Prognostic significance of multiple kallikreins in high-grade astrocytoma.
26172508 2015 MicroRNA-375 Suppresses Extracellular Matrix Degradation and Invadopodial Activity in Head and Neck Squamous Cell Carcinoma.
25990935 2015 Kallikrein-related peptidase 6 regulates epithelial-to-mesenchymal transition and serves as prognostic biomarker for head and neck squamous cell carcinoma patients.
25649006 2015 Evaluation of human tissue kallikrein-related peptidases 6 and 10 expression in early gastroesophageal adenocarcinoma.
25477184 2014 Kallikrein family proteases KLK6 and KLK7 are potential early detection and diagnostic biomarkers for serous and papillary serous ovarian cancer subtypes.
25476568 2014 Accumulation of ?-synuclein in dementia with Lewy bodies is associated with decline in the ?-synuclein-degrading enzymes kallikrein-6 and calpain-1.
25153391 2014 Kallikrein-related peptidase 6 (KLK6) expression in the progression of colon adenoma to carcinoma.
25153389 2014 Prognostic significance of human tissue kallikrein-related peptidases 6 and 10 in gastric cancer.
24979321 2014 Progression from cirrhosis to cancer is associated with early ubiquitin post-translational modifications: identification of new biomarkers of cirrhosis at risk of malignancy.
24669031 2014 Identification of human tissue kallikrein 6 as a potential marker of laryngeal cancer based on the relevant secretory/releasing protein database.
More...