Property Summary

NCBI Gene PubMed Count 15
PubMed Score 48.80
PubTator Score 13.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.9e-03
Atopic dermatitis 952 4.0e-03
Disease Target Count Z-score Confidence
Restless legs syndrome 27 4.13 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -1.400 4.0e-03
psoriasis 1.900 3.9e-03

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVS      1 - 70
ALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTG     71 - 140
ERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCS    141 - 210
YVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQT    211 - 280
QALAISDHFPVEVTLKFHR                                                       281 - 299
//

Text Mined References (16)

PMID Year Title