Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $198,632.33
PubMed Score 37.58
PubTator Score 15.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q92871 A8K003 Q92586 PMM 1
Symbols Sec53

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

2FUC   2FUE  

Gene RIF (6)

PMID Text
18927083 PMM1 is responsible for the degradation of Glc-1,6-P(2) in brain
18854154 Knockdown of phosphomannomutase 1 (PMM1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18591914 The genes GUS and PMM1 are recommended for normalization purposes in gene expression studies of liver tissue from patients with chronic hepatitis.
17186415 analysis of mental development in a patient with phosphomannomutase deficiency who is compound heterozygous for T237R/C241S mutations [case report]
16540464 human alpha-phosphomannomutase 1 crystallographic structure reveals the structural basis of congenital disorder of glycosylation type 1a
12789572 Mutations in phosphomannomutase is associated with ophthalmic manifestations of congenital disorder of glycosylation type 1a

AA Sequence

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVI      1 - 70
EKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISP     71 - 140
IGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSF    141 - 210
DTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA                      211 - 262
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
18927083 2008 Mammalian phosphomannomutase PMM1 is the brain IMP-sensitive glucose-1,6-bisphosphatase.
18591914 2008 GUS and PMM1 as suitable reference genes for gene expression analysis in the liver tissue of patients with chronic hepatitis.
17186415 2007 Borderline mental development in a congenital disorder of glycosylation (CDG) type Ia patient with multisystemic involvement (intermediate phenotype).
17054774 2006 Expression of full-length p53 and its isoform Deltap53 in breast carcinomas in relation to mutation status and clinical parameters.
16540464 2006 The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...