Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
R01 Count 10
Funding $714,415.75
PubMed Score 11.04
PubTator Score 10.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma -1.100 0.006
oligodendroglioma 1.200 0.047
psoriasis -3.600 0.000
osteosarcoma -3.270 0.000
chronic lymphosyte leukemia 1.200 0.000
tuberculosis and treatment for 6 months 1.400 0.018
primary pancreatic ductal adenocarcinoma 1.425 0.021
intraductal papillary-mucinous adenoma (... 1.600 0.003
lung cancer -1.200 0.020
group 3 medulloblastoma -1.300 0.003
subependymal giant cell astrocytoma -1.854 0.045
Pick disease -1.100 0.000
ovarian cancer -2.100 0.000
pancreatic cancer 1.100 0.016

Gene RIF (12)

PMID Text
27157394 APBB2 was differentially expressed between Fibromyalgia patients and healthy controls.
26194614 results provide additional evidence of a genetic interaction between GSK3beta and APBB2 and further suggest that GSK3beta is involved in the pathophysiology of both of the primary neuropathologies of Alzheimer's disease
23384821 The APBB2 rs13133980 G allele was over-represented in centenarians with severe cognitive impairment compared to individuals without this disability.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19542221 The differential processing of amyloid-beta precursor via secretase enzymes regulates the proliferation and differentiation of human embryonic stem cell.
18852029 The hCV1558625 G allele was over-represented in patients with onset under age 70 compared to controls in the same age range.
18852029 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17567906 In response to TNF, Zfra is upregulated and modulates TNF-mediated cell death via interacting with TRADD, FADD and RIP (death-inducing signaling complex) at the receptor level, and downstream effectors NF-kappaB, p53, WOX1, and JNK1.
16083851 the apoptosis inhibitory domain of FE65-like protein 1 regulates both apoptotic and caspase-independent programmed cell death mediated by TNF
15714520 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKY      1 - 70
ALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPTAVINITSEKLEGKEP     71 - 140
HPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRGNHHGTAEEKSQPVQGQASTIIGNGDLLLQK    141 - 210
PNRPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDI    211 - 280
WSDHSFQTDPDLPPGWKRVSDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQP    281 - 350
WSDFAVLNGGKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFA    351 - 420
VRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVL    421 - 490
HSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALAC    491 - 560
SSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNM    561 - 630
NVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQA    631 - 700
ACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP                701 - 758
//

Text Mined References (30)

PMID Year Title
27157394 Genome-wide expression profiling in the peripheral blood of patients with fibromyalgia.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26194614 2015 GSK3? Interactions with Amyloid Genes: An Autopsy Verification and Extension.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24143882 2014 Genome-wide association study of opioid dependence: multiple associations mapped to calcium and potassium pathways.
23384821 2013 APBB2 genetic polymorphisms are associated with severe cognitive impairment in centenarians.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...