Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.31
PubTator Score 10.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
chronic lymphosyte leukemia 1.200 4.8e-04
ependymoma -1.100 6.3e-03
group 3 medulloblastoma -1.300 3.4e-03
intraductal papillary-mucinous adenoma (... 1.600 3.1e-03
lung cancer -1.200 2.0e-02
oligodendroglioma 1.200 4.7e-02
osteosarcoma -1.277 4.8e-03
ovarian cancer -1.400 5.1e-09
pancreatic cancer 1.100 1.6e-02
Pick disease -1.100 7.5e-05
primary pancreatic ductal adenocarcinoma 1.425 2.1e-02
psoriasis -1.100 3.9e-06
subependymal giant cell astrocytoma -1.854 4.5e-02
tuberculosis and treatment for 6 months 1.200 1.3e-02

Synonym

Accession Q92870 B4DSL4 E9PG87 Q8IUI6
Symbols FE65L
FE65L1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

AA Sequence

MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKY      1 - 70
ALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPTAVINITSEKLEGKEP     71 - 140
HPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRGNHHGTAEEKSQPVQGQASTIIGNGDLLLQK    141 - 210
PNRPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDI    211 - 280
WSDHSFQTDPDLPPGWKRVSDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQP    281 - 350
WSDFAVLNGGKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFA    351 - 420
VRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVL    421 - 490
HSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALAC    491 - 560
SSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNM    561 - 630
NVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQA    631 - 700
ACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP                701 - 758
//

Text Mined References (30)

PMID Year Title