Property Summary

NCBI Gene PubMed Count 36
Grant Count 80
R01 Count 51
Funding $7,502,568.21
PubMed Score 109.74
PubTator Score 41.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.982 0.000
astrocytoma 1.300 0.009
lung adenocarcinoma -1.100 0.000
sonic hedgehog group medulloblastoma 1.100 0.002
subependymal giant cell astrocytoma -1.047 0.016
invasive ductal carcinoma -1.010 0.012
lung carcinoma 1.700 0.000
ovarian cancer -2.000 0.000
pituitary cancer 1.200 0.000

Synonym

Accession Q92859 B7ZKM9 B7ZKN0 O00340 Q17RX1
Symbols NGN
IGDCC2
NTN1R2

Gene

PDB

1X5F   1X5G   1X5H   1X5I   1X5J   1X5K   3P4L  

Gene RIF (27)

PMID Text
27029596 Neogenin influences both cadherin dynamics and junctional tension.
26518331 The hemizygous 15q deletion unmasks the recessive functional polymorphism in NEO1 which plays a pivotal role in cortical interneuron development; study provides the first evidence linking NEO1 with autism spectrum disorders in humans
25998984 The present study demonstrates that neogenin may be a tumor suppressor in breast cancer. Neogenin may serve as a potential diagnostic marker and therapeutic target for breast cancer.
25938661 These results show how repulsive guidance molecule acts as the central hub that links BMP2 and NEO1 and physically connects these fundamental signaling pathways.
25909166 Ntn4 promotes the proliferation and motility of gastric cancer cells which is mediated by its receptor Neo and through further activation of multi-oncogenic pathways
25416629 Neogenin expression is inversely associated with breast cancer grade.
24930499 high-expression of neogenin-1 promotes gastric cancer proliferation and motility
24657544 miR-18a may regulate biological behavior of human glioblastoma cells by targeting neogenin.
23775842 these results highlight Neogenin1 as a novel downstream effector of the Sonic Hedgehog pathway in medulloblastoma
23744777 two RGMB ectodomains conformationally stabilize the juxtamembrane regions of two NEO1 receptors in a pH-dependent manner.
More...

AA Sequence

MAAERGARRLLSTPSFWLYCLLLLGRRAPGAAAARSGSAPQSPGASIRTFTPFYFLVEPVDTLSVRGSSV      1 - 70
ILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTII     71 - 140
SRTAKLIVAGLPRFTSQPEPSSVYAGNNAILNCEVNADLVPFVRWEQNRQPLLLDDRVIKLPSGMLVISN    141 - 210
ATEGDGGLYRCVVESGGPPKYSDEVELKVLPDPEVISDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTI    211 - 280
KWMKNEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNI    281 - 350
YAHESMDIVFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQ    351 - 420
AGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGIARERVENT    421 - 490
SHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNLRAYAASPTSITVTWE    491 - 560
TPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLS    561 - 630
DVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLD    631 - 700
RGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRG    701 - 770
YAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFV    771 - 840
INAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANA    841 - 910
TTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPP    911 - 980
SEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFR    981 - 1050
TPKADSSDKMPNDQASGSGGKGSRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVV   1051 - 1120
VIIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPI   1121 - 1190
PRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDN   1191 - 1260
PHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGA   1261 - 1330
TSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALPSTPLLSQQALNHHIHSVKTA   1331 - 1400
SIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA            1401 - 1461
//

Text Mined References (42)

PMID Year Title
27029596 2016 Neogenin recruitment of the WAVE regulatory complex maintains adherens junction stability and tension.
26518331 2016 Unmasking a novel disease gene NEO1 associated with autism spectrum disorders by a hemizygous deletion on chromosome 15 and a functional polymorphism.
25998984 2015 Overexpression of neogenin inhibits cell proliferation and induces apoptosis in human MDA-MB-231 breast carcinoma cells.
25938661 2015 Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein.
25909166 2015 Netrin-4 as a biomarker promotes cell proliferation and invasion in gastric cancer.
25416629 2014 Neogenin expression is inversely associated with breast cancer grade in ex vivo.
24930499 2014 Up-regulation of neogenin-1 increases cell proliferation and motility in gastric cancer.
24657544 2014 MiR-18a regulates the proliferation, migration and invasion of human glioblastoma cell by targeting neogenin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23775842 2014 Neogenin1 is a Sonic Hedgehog target in medulloblastoma and is necessary for cell cycle progression.
More...