Property Summary

NCBI Gene PubMed Count 43
Grant Count 234
R01 Count 134
Funding $28,563,876.36
PubMed Score 194.19
PubTator Score 115.37

Knowledge Summary

Patent

No data available

Synonym

Accession Q92858 Q14CT9
Symbols ATH1
HATH1
MATH-1
bHLHa14

Gene

PANTHER Protein Class (2)

Gene RIF (37)

PMID Text
26648003 Downregulation of Hath1 expression promoted the proliferation and reduced the apoptosis of KUMA5 squamous cell carcinoma cells.
26487780 Atoh1 epigenetic regulation guides hair cell development in the mammalian cochlea
26017781 Atoh1 protein stabilization induced both a cancer stem cell phenotype and a mucinous phenotype, resulting in the acquisition of chemoresistance in colorectal cancer
25957791 Testosterone-bovine serum albumin and Math1 treatment could promote an increase in hair-cell like cells in the lesser epithelial ridge through proliferation and transdifferentiation.
25950549 ATOH1 can induce the differentiation of gastric cancer stem cells.
25648190 In this review, expression of the Atoh1 gene in supporting cells, results in their transformation into immature hair cells.
25412697 Chicken Atoh1 might have intrinsic functional differences to mammalian Atoh1.
25400808 Data suggest that Atoh1 high expression correlates with a good prognosis and it may serve as a favorable prognostic factor for GIST.
25015561 ATOH1 acts in concert with other transcription factors to directly regulate the cochlear hair cell phenotype.
24904172 Atoh1 transfection drives highly efficient differentiation of human pluripotent stem cells into dopaminergic neurons.
More...

AA Sequence

MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQ      1 - 70
GICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDEL     71 - 140
GCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINA    141 - 210
LSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPA    211 - 280
SAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDS    281 - 350
DEAS                                                                      351 - 354
//

Text Mined References (43)

PMID Year Title
26648003 2015 Effect of Hath1 on the proliferation and apoptosis of cutaneous squamous cell carcinoma in vitro.
26487780 2015 Epigenetic regulation of Atoh1 guides hair cell development in the mammalian cochlea.
26017781 2015 Atonal homolog 1 protein stabilized by tumor necrosis factor ? induces high malignant potential in colon cancer cell line.
25957791 2015 Role of the planar cell polarity pathway in regulating ectopic hair cell-like cells induced by Math1 and testosterone treatment.
25950549 2015 ATOH1 Can Regulate the Tumorigenicity of Gastric Cancer Cells by Inducing the Differentiation of Cancer Stem Cells.
25648190 2015 Atoh1 gene therapy in the cochlea for hair cell regeneration.
25412697 2015 Molecular cloning and functional characterisation of chicken Atonal homologue 1: a comparison with human Atoh1.
25400808 2014 Upregulation of Atoh1 correlates with favorable survival in gastrointestinal stromal tumor.
25015561 2015 Transcription factors with conserved binding sites near ATOH1 on the POU4F3 gene enhance the induction of cochlear hair cells.
24904172 2014 Proneural transcription factor Atoh1 drives highly efficient differentiation of human pluripotent stem cells into dopaminergic neurons.
More...