Property Summary

NCBI Gene PubMed Count 48
PubMed Score 206.54
PubTator Score 115.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
medulloblastoma 720 0.0 0.0143309714682709
Disease Target Count
Alcohol Toxicity 2
Disease Target Count P-value
psoriasis 6694 4.6e-11
atypical teratoid / rhabdoid tumor 5112 4.7e-05
glioblastoma 5792 1.3e-04
medulloblastoma, large-cell 6241 5.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Sensorineural hearing loss 106 4.276 2.1
Cancer 2499 3.226 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma 1.400 1.4e-02
atypical teratoid / rhabdoid tumor 1.100 4.7e-05
glioblastoma 1.100 1.3e-04
medulloblastoma, large-cell 1.100 5.2e-04
psoriasis -1.800 4.6e-11

 GO Component (1)

Gene RIF (42)

AA Sequence

MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQ      1 - 70
GICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDEL     71 - 140
GCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINA    141 - 210
LSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPA    211 - 280
SAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDS    281 - 350
DEAS                                                                      351 - 354
//

Text Mined References (48)

PMID Year Title