Property Summary

NCBI Gene PubMed Count 69
Grant Count 50
R01 Count 31
Funding $8,680,772.91
PubMed Score 160.52
PubTator Score 155.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (48)

PMID Text
26910109 Semaphorin 4D Promotes Skeletal Metastasis in Breast Cancer.
26740106 this study describes a novel immunosuppressive role for Sema4D in head and neck squamous cell carcinoma through induction of myeloid derived suppressor cells
26417899 Serum sSema4D levels are increased in patients with atrial fibrillation and are independently associated with atrial remodeling
26275342 Blocking of CD100, plexin B1 and/or B2 in adhesion experiments have shown that both CD100 and plexins act as adhesion molecules involved in monocyte-endothelial cell binding.
26051877 Plexin-B1 induces cutaneous squamous cell carcinoma cell proliferation, migration, and invasion by interacting with Sema4D. Plexin-B1 might serve as a useful biomarker and/or as a novel therapeutic target for cSCC.
26035216 Results show that decreased expression of Sema4D, plexin-B1 and -B2 was associated with local recurrence and poor prognosis of breast neoplasm.
25717256 Suggest that HIF-1alpha and Sema4D expression correlates with histological tumor type, TNM stage, and lymphatic metastasis in colorectal carcinoma.
25707877 A positive feedback loop involving sSema4D/IL-6 and TNFalpha/ADAMTS-4 may contribute to the pathogenesis of rheumatoid arthritis.
25275127 HIV-1 gp120 upregulates the expression of semaphoring-4D (SEMA4D) in human B cells
25275127 HIV-1 gp120 upregulates the expression of semaphoring-4D (SEMA4D) in human B cells
More...

AA Sequence

MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAV      1 - 70
FAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNL     71 - 140
TSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPS    141 - 210
FVFADVIRKSPDSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLI    211 - 280
CSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQ    281 - 350
SHTKWVRYNGPVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY    351 - 420
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSSKKGNRFVYAG    421 - 490
SNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSRGLIQEMSGDASVCPDKSKGS    491 - 560
YRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPKYGLMGRKNLLIFNLSEGDSGVYQCLSEERV    561 - 630
KNKTVFQVVAKHVLEVKVVPKPVVAPTLSVVQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPK    631 - 700
PAPTGTSCEPKIVINTVPQLHSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSA    701 - 770
LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS    771 - 840
ARDKPFDVKCELKFADSDADGD                                                    841 - 862
//

Text Mined References (71)

PMID Year Title
26910109 2016 Semaphorin 4D Promotes Skeletal Metastasis in Breast Cancer.
26740106 2016 Human Head and Neck Squamous Cell Carcinoma-Associated Semaphorin 4D Induces Expansion of Myeloid-Derived Suppressor Cells.
26417899 2015 Serum Soluble Semaphorin 4D is Associated with Left Atrial Diameter in Patients with Atrial Fibrillation.
26275342 2015 CD100 and plexins B2 and B1 mediate monocyte-endothelial cell adhesion and might take part in atherogenesis.
26051877 2015 Plexin-B1 and semaphorin 4D cooperate to promote cutaneous squamous cell carcinoma cell proliferation, migration and invasion.
26035216 2015 Reduced expression of semaphorin 4D and plexin-B in breast cancer is associated with poorer prognosis and the potential linkage with oestrogen receptor.
25717256 2015 Semaphorin 4D and hypoxia-inducible factor-1? overexpression is related to prognosis in colorectal carcinoma.
25707877 2015 Semaphorin 4D Contributes to Rheumatoid Arthritis by Inducing Inflammatory Cytokine Production: Pathogenic and Therapeutic Implications.
25135716 2014 Expression and clinical significance of Semaphorin4D in non-small cell lung cancer and its impact on malignant behaviors of A549 lung cancer cells.
25108441 2014 [Alteration of CD100 expression on natural killer cells in chronic patients with hepatitis C virus before and after initiation of antiviral treatment].
More...