Property Summary

NCBI Gene PubMed Count 120
Grant Count 49
R01 Count 20
Funding $3,070,655.74
PubMed Score 85.96
PubTator Score 145.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.011
osteosarcoma -1.834 0.000
lung cancer -2.600 0.000
active Crohn's disease 1.081 0.015
active ulcerative colitis 1.130 0.012
interstitial cystitis 1.100 0.001
lung carcinoma -1.800 0.000
ovarian cancer 1.100 0.000

 GWAS Trait (1)

Gene RIF (79)

PMID Text
26323380 Three cases of autoimmune lymphoproliferative syndrome due to somatic FAS mutation (ALPS-sFAS) combined with a germline CASP10 variation have been described.
26164758 Results showed miR-221/222 promote cell proliferation and repress apoptosis, through suppressing caspase-10, in prostate cancer cells.
25403406 proinflammatory (caspase 1) and initiator (caspases 8 and 10) caspases in the syncytiotrophoblast and capillary endotheliocytes of the terminal villi are higher in induced pregnancies.
25370148 Levels of caspase-9, caspase-10, MAVS, and pIRF7 in mononuclear cells and the disease activity index (SLEDAI) in the systemic lupus erythematosus patients were determined.
25330190 We have also demonstrated that these correlations are tissue specific being reduced (CASP9 and CASP10) or different (CASP2) in the liver
23921907 Single nucleotide polymorphisms in CASP10 gene is associated with gastric cancer.
23541952 While myeloma cells require a basal level of autophagy for survival, caspase-10 tempers this response to avoid cell death.
23303631 Results found that polymorphisms of CASP9 and CASP10 genes may not contribute to CRC risk in Chinese population.
23212337 This meta-analysis suggests that the rs13006529 T carrier in the CASP-10 gene might be a risk factor for cancer susceptibility, especially for breast cancer.
22843554 Genetic variations in CASP8 and CASP10 may act as potential predictive biomarkers for platinum-based chemotherapy toxicity in Chinese non-small cell lung cancer patients.
More...

AA Sequence

MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDL      1 - 70
LSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKD     71 - 140
SLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQG    141 - 210
EEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNR    211 - 280
NHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDC    281 - 350
FVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE    351 - 420
QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKTMEIRGRKRTV    421 - 490
WGAKQISATSLPTAISAQTPRPPMRRWSSVS                                           491 - 521
//

Text Mined References (122)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26323380 2016 Autoimmune lymphoproliferative syndrome due to somatic FAS mutation (ALPS-sFAS) combined with a germline caspase-10 (CASP10) variation.
26164758 2015 Effects of microRNA-221/222 on cell proliferation and apoptosis in prostate cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25403406 2014 Caspase expression in placental terminal villi in spontaneous and induced pregnancy.
25370148 2014 Investigation of the caspase-dependent mitochondrial apoptotic pathway in mononuclear cells of patients with systemic Lupus erythematosus.
25330190 2014 Transcriptomic analysis unveils correlations between regulative apoptotic caspases and genes of cholesterol homeostasis in human brain.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
23921907 2014 Genetic variants in fas signaling pathway genes and risk of gastric cancer.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
More...