Property Summary

Ligand Count 5
NCBI Gene PubMed Count 125
PubMed Score 89.10
PubTator Score 145.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.081 1.5e-02
active ulcerative colitis 1.130 1.2e-02
cutaneous lupus erythematosus 1.200 1.1e-02
interstitial cystitis 1.100 6.2e-04
lung cancer -1.100 1.2e-02
lung carcinoma -1.800 8.3e-32
osteosarcoma -1.834 9.6e-06
ovarian cancer 1.100 1.5e-08

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (82)

AA Sequence

MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDL      1 - 70
LSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKD     71 - 140
SLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQG    141 - 210
EEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNR    211 - 280
NHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDC    281 - 350
FVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE    351 - 420
QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKTMEIRGRKRTV    421 - 490
WGAKQISATSLPTAISAQTPRPPMRRWSSVS                                           491 - 521
//

Text Mined References (129)

PMID Year Title