Property Summary

NCBI Gene PubMed Count 129
Grant Count 154
R01 Count 78
Funding $11,773,024.81
PubMed Score 324.52
PubTator Score 454.20

Knowledge Summary

Patent (34,605)

Synonym

Accession Q92847 Q14D12 Q6ISR8 Q92848 Q96RJ7 GHS-R
Symbols GHDP

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

 GWAS Trait (1)

Gene RIF (125)

PMID Text
27129257 GHS-R1b not only determines the efficacy of ghrelin-induced GHS-R1a-mediated signaling but also determines the ability of GHS-R1a to form oligomeric complexes with other receptors.
25727097 Study demonstrates that the GHS-R1a/5-HT2C receptor interaction translates into a biologically significant modulation of ghrelin's orexigenic effect
25603164 The data indicates that GHSR hypermethylation is a pan-cancer marker regardless of the tissue from which the tumor originates.
25524946 the single nucleotide polymorphism of GHSR might be weaker association with cancer risk, especially with breast cancer risk
25376984 This study suggests that the rs696217 and rs2075356 ghrelin gene (GHRL) polymorphisms may protect carriers against breast cancer, and the rs4684677 GHRL and rs572169 GHSR polymorphisms may increase the risk among carriers.[Meta-analysis]
25261469 findings suggest an avenue for modulating drug abuse-associated changes in synaptic plasticity via GHSR1a and indicate the development of GHSR1a-biased ligands as a promising strategy for selectively targeting downstream signaling events.
25200304 Data (including data from knockout mice) suggest ghrelin produced in pancreatic islets regulates insulin secretion and thereby regulates blood glucose; ghrelin signaling via growth hormone secretagogue-receptor appears to be involved. [REVIEW]
24809812 The Ghr and GHSR-1a were co-expressed by the pigmented epithelium (PE) of the CB, by the retinal pigmented epithelium (RPE) and by the anterior limiting layer (ALL) of the iris.
24651458 Data indicate that activation of growth hormone secretagogue receptor (GHSR) may trigger a diversity of signaling mechanisms and subsequent distinct physiological responses.
24194510 Studies suggest that dysregulation in the components of the ghrelin system including ghrelin, ghrelin receptor (GHSR1a) and ghrelin-O-acyl-transferase can lead to or influence the development and/or progression of highly concerning pathologies.
More...

AA Sequence

MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSR      1 - 70
FRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVE     71 - 140
RYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLL    141 - 210
TVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFH    211 - 280
VGRYLFSKSFEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLST    281 - 350
LKDESSRAWTESSINT                                                          351 - 366
//

Text Mined References (129)

PMID Year Title
27129257 2016 A Significant Role of the Truncated Ghrelin Receptor GHS-R1b in Ghrelin-induced Signaling in Neurons.
25727097 2015 Ghrelin's Orexigenic Effect Is Modulated via a Serotonin 2C Receptor Interaction.
25603164 2015 GHSR hypermethylation: a promising pan-cancer marker.
25524946 2015 No association of single nucleotide polymorphisms involved in GHRL and GHSR with cancer risk: a meta-analysis.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25376984 2014 Associations between ghrelin and ghrelin receptor polymorphisms and cancer in Caucasian populations: a meta-analysis.
25261469 2014 G Protein and ?-arrestin signaling bias at the ghrelin receptor.
25200304 2014 Ghrelin signalling in ?-cells regulates insulin secretion and blood glucose.
24809812 2014 Novel evidence of ghrelin and growth hormone segretagogue receptor expression by human ocular tissues.
24651458 2014 The growth hormone secretagogue receptor: its intracellular signaling and regulation.
More...