Property Summary

Ligand Count 461
NCBI Gene PubMed Count 137
PubMed Score 350.17
PubTator Score 454.20

Knowledge Summary

Patent (34,605)

Gene RIF (133)

AA Sequence

MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSR      1 - 70
FRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVE     71 - 140
RYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLL    141 - 210
TVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFH    211 - 280
VGRYLFSKSFEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLST    281 - 350
LKDESSRAWTESSINT                                                          351 - 366
//

Text Mined References (137)

PMID Year Title