Property Summary

NCBI Gene PubMed Count 28
Grant Count 7
R01 Count 5
Funding $1,392,621
PubMed Score 23.51
PubTator Score 24.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.300 0.000
active ulcerative colitis -1.288 0.031
adult high grade glioma -1.100 0.000
Pick disease -1.400 0.000
acute myeloid leukemia -1.900 0.039
ovarian cancer 1.800 0.000

 GO Function (1)

Gene RIF (14)

PMID Text
25588831 These data suggest that GLI interactions with KIF3A-KIF3B-KAP3 complexes are essential for proper GLI transcriptional activity.
24838185 Common genetic variation in the Kinesin-Associated Protein 3 (KIFAP3) gene (rs1541160) was reported to have a significant effect on survival in amyotrophic lateral sclerosis patients.
21659726 The incidence of the motor neuron-predominant amyotrophic lateral sclerosis phenotype in the patients of this cohort supports the hypothesis that the SNP within the KIFAP3 gene is a potential modifier of the amyotrophic lateral sclerosis phenotype
20566859 Data clearly show that SNP rs1541160 does not modify survival within cohort of 504 Italian ALS cases.
20566859 Observational study of gene-disease association. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
20016921 Using acetylated HIV-1 IN as bait in yeast two-hybrid screening identifies transcription regulatory and chromatin remodeling factors LEDGF/p75, KAP1, BTF3b, THRAP3, and HMGN2 as IN-binding partners
19451621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19451621 a variant within the KIFAP3 gene that is associated with decreased KIFAP3 expression and increased survival in sporadic ALS was identified.
19088126 KAP3 sequestration by misfolded SOD1 and the inhibition of ChAT transport play a role in the dysfunction of amyotrophic lateral sclerosis.
More...

AA Sequence

MQGEDARYLKRKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKIIRLKSLNANTDITSL      1 - 70
ARKVVEECKLIHPSKLNEVEQLLYYLQNRRDSLSGKEKKEKSSKPKDPPPFEGMEIDEVANINDMDEYIE     71 - 140
LLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIFFCFSSFSQF    141 - 210
HGLITHYKIGALCMNIIDHELKRHELWQEELSKKKKAVDEDPENQTLRKDYEKTFKKYQGLVVKQEQLLR    211 - 280
VALYLLLNLAEDTRTELKMRNKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLV    281 - 350
KMIPCEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKSMF    351 - 420
AYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKFKDPLLMKMIRNI    421 - 490
SQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAA    491 - 560
EDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIK    561 - 630
ETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLY    631 - 700
GDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGI    701 - 770
LGRPATAYGFRPDEPYYYGYGS                                                    771 - 792
//

Text Mined References (32)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25588831 2015 The heterotrimeric kinesin-2 complex interacts with and regulates GLI protein function.
25416956 2014 A proteome-scale map of the human interactome network.
24838185 2014 Analysis of the KIFAP3 gene in amyotrophic lateral sclerosis: a multicenter survival study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21659726 2011 Genetic variation in KIFAP3 is associated with an upper motor neuron-predominant phenotype in amyotrophic lateral sclerosis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...