Property Summary

NCBI Gene PubMed Count 57
Grant Count 20
R01 Count 17
Funding $952,003.25
PubMed Score 65.44
PubTator Score 1574.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
26363073 these results suggest that TANK is a novel target of some viral proteases, indicating that some positive RNA viruses have evolved to utilize their major proteases to regulate NF-kappaB activation.
25861989 TANK serves as an important negative regulator of NF-kappaB signaling cascades induced by genotoxic stress and IL-1R/Toll-like receptor stimulation in a manner dependent on MCPIP1/USP10-mediated TRAF6 deubiquitination.
23634849 Two SNPs in TANK (rs17705608 and rs7309) were significantly associated with breast cancer risk in our study sample.
23428248 two TANK gene polymorphisms (rs1921310, rs3820998) do not play a significant role in pathogenesis of chronic periodontitis or peri-implantitis among the Iranian population
23286385 Studies show that three proteins expressed in HEK-293T cells (NAP1, TANK and TBKBP1) interact with TBK1.
22225470 TANK plays a role in the pathogenesis of acute-on-chronic hepatitis B liver failure (ACLF-HBV) patients and liver cirrhosis patients.
21625535 MARCH5 is an authentic E3 ubiquitin ligase and catalyzes K63-linked polyubiquitination of TANK. MARCH5 modulates TLR7 signaling via releasing the inhibitory action of TANK toward TRAF6.
21212807 SUMO modification of TANK alleviates its repression of TLR7 signalling
20644899 Expression of TRF2 and TANK1 increased in monoclonal gammopathy of undetermined significance and multiple myeloma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQD      1 - 70
NNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRKETSARSLGSPLLHERGNIEK     71 - 140
TFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVPIQCTDKTDKQEALFKPQAKDDINRGAPSIT    141 - 210
SVTPRGLCRDEEDTSFESLSKFNVKFPPMDNDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNF    211 - 280
VKTEETLFEIQGIDPIASAIQNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDA    281 - 350
PFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH    351 - 420
FNGET                                                                     421 - 425
//

Text Mined References (66)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26363073 2015 Encephalomyocarditis Virus 3C Protease Relieves TRAF Family Member-associated NF-?B Activator (TANK) Inhibitory Effect on TRAF6-mediated NF-?B Signaling through Cleavage of TANK.
25861989 2015 TRAF Family Member-associated NF-?B Activator (TANK) Inhibits Genotoxic Nuclear Factor ?B Activation by Facilitating Deubiquitinase USP10-dependent Deubiquitination of TRAF6 Ligase.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24008843 2013 Structure homology and interaction redundancy for discovering virus-host protein interactions.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
More...