Property Summary

NCBI Gene PubMed Count 78
Grant Count 82
R01 Count 62
Funding $7,197,380.35
PubMed Score 95.44
PubTator Score 107.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.700 0.015
posterior fossa group A ependymoma -2.000 0.000
oligodendroglioma -1.200 0.050
glioblastoma -2.100 0.000
osteosarcoma 1.177 0.000
group 4 medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.300 0.000
colon cancer -1.200 0.001
adult high grade glioma -2.500 0.000
pilocytic astrocytoma -1.300 0.000
lung adenocarcinoma -1.200 0.000
invasive ductal carcinoma -1.300 0.005
ovarian cancer 1.200 0.000
psoriasis 1.300 0.000
facioscapulohumeral dystrophy 2.100 0.000

Synonym

Accession Q92843 A8K0F4 Q2M3U0 Q5U0H4 Bcl2-L-2
Symbols BCLW
BCL-W
PPP1R51
BCL2-L-2

Gene

PANTHER Protein Class (1)

PDB

1ZY3   1MK3   1O0L   2Y6W   4CIM  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
952 screening 47 / 447 / 194372 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W.
1330 confirmatory 18 / 0 / 816 Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W.
2081 confirmatory 5 / 0 / 37 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W

Gene RIF (40)

PMID Text
27048913 Genetic and pharmacological inhibition of BCL-W and BCL-XL causes directed elimination of senescent cells.
26155940 Data show that BCL2-like 2 protein (BCL2L2) is a direct target of micrRNA miR-29b.
25874488 miR-15a acts as a tumor suppressor in NSCLC by directly targeting BCL2L2 and may serve as a potential diagnostic biomarker and therapeutic target for NSCLC.
25846734 these results indicate that miR-335 acts as a novel tumor suppressor to regulate ccRCC cell proliferation and invasion through downregulation of BCL-W expression.
25371206 The crystal structures of BCL-W and BCL-XL, along with cellular, studies reveal critical features of the BH3 domains of pro-survival proteins that distinguish them functionally from their pro-apoptotic counterparts.
24946210 HDMF inhibits Bcl-w-induced neurosphere formation and the expression of glioma stem cell markers, such as Musashi, Sox-2 and c-myc.
24747052 Crystal structure of human BCL-W in complex with different DARPins is virtually identical to the ligand-free conformation of its closest relative BCL-XL.
24646834 A structural basis for a conserved binding mechanism between p53DBD and the anti-apoptotic Bcl-2 family proteins.
24552705 Bcl-w-induced Sp1 activation is a potential marker for aggressiveness of glioblastoma multiforme.
23708561 MiR-335 lacks of expression brings about the abnormal accumulation of Bcl-w.
More...

AA Sequence

MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV      1 - 70
TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHS     71 - 140
SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK                     141 - 193
//

Text Mined References (88)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27048913 2016 Directed elimination of senescent cells by inhibition of BCL-W and BCL-XL.
26155940 2015 miR-29b attenuates tumorigenicity and stemness maintenance in human glioblastoma multiforme by directly targeting BCL2L2.
25874488 2015 MicroRNA-15a induces cell apoptosis and inhibits metastasis by targeting BCL2L2 in non-small cell lung cancer.
25846734 2015 miR-335 inhibits the proliferation and invasion of clear cell renal cell carcinoma cells through direct suppression of BCL-W.
25416956 2014 A proteome-scale map of the human interactome network.
25371206 2014 The functional differences between pro-survival and pro-apoptotic B cell lymphoma 2 (Bcl-2) proteins depend on structural differences in their Bcl-2 homology 3 (BH3) domains.
24946210 2014 3-Hydroxy-3',4'-dimethoxyflavone suppresses Bcl-w-induced invasive potentials and stemness in glioblastoma multiforme.
24747052 2014 Co-crystallization with conformation-specific designed ankyrin repeat proteins explains the conformational flexibility of BCL-W.
24646834 2014 A conserved mechanism for binding of p53 DNA-binding domain and anti-apoptotic Bcl-2 family proteins.
More...