Property Summary

NCBI Gene PubMed Count 46
Grant Count 3
Funding $256,922.1
PubMed Score 135.65
PubTator Score 103.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.039
interstitial lung disease 1.600 0.007
astrocytic glioma 3.100 0.010
ependymoma 3.100 0.016
oligodendroglioma 3.900 0.001
psoriasis -1.500 0.000
osteosarcoma 4.919 0.000
medulloblastoma 1.300 0.000
primitive neuroectodermal tumor 1.600 0.000
Crohn's disease -1.191 0.002
juvenile dermatomyositis 1.194 0.000
acute quadriplegic myopathy 1.103 0.007
intraductal papillary-mucinous adenoma (... 1.500 0.002
breast carcinoma 1.500 0.016
cystic fibrosis -2.800 0.000
invasive ductal carcinoma 1.059 0.033
Pick disease 1.300 0.003
progressive supranuclear palsy -1.100 0.007
Breast cancer -2.300 0.031
ovarian cancer -4.100 0.000
head and neck cancer and chronic obstruc... -1.700 0.009

Synonym

Accession Q92841 B1AHM0 Q69YT1 Q6ICD6
Symbols P72
RH70

Gene

Gene RIF (41)

PMID Text
26362536 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
26312911 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
26312911 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
26312911 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
26312911 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
26209609 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DDX5 and DDX17 RNA Helicases
25701821 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
25701821 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
25701821 siRNA knockdown of DDX17 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
25496916 HIV-1 Gag interacts with DDX17 as demonstrated by proximity dependent biotinylation proteomics and validated via immunoprecipitation and western blot analysis
More...

AA Sequence

MPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQALPSPAIRAP      1 - 70
LPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPE     71 - 140
VARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRD    141 - 210
MVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYG    211 - 280
GAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR    281 - 350
QTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK    351 - 420
TIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFV    421 - 490
INYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGG    491 - 560
GGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQA    561 - 630
GQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQP    631 - 700
PGATNMIGYMGQTAYQYPPPPPPPPPSRK                                             701 - 729
//

Text Mined References (64)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26209609 2015 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box (DDX)-5/17 RNA Helicases.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25604459 2015 Identification of cytoplasmic proteins interacting with unliganded estrogen receptor ? and ? in human breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25126784 2014 Stem-loop recognition by DDX17 facilitates miRNA processing and antiviral defense.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
More...