Property Summary

NCBI Gene PubMed Count 49
PubMed Score 1400.64
PubTator Score 160.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma -1.200 2.1e-04
malignant mesothelioma -5.100 7.3e-10
ovarian cancer -2.900 4.9e-15
pituitary cancer 1.300 4.6e-05
primitive neuroectodermal tumor -1.200 9.1e-05
tuberculosis -1.200 9.7e-04

 GO Function (1)

Gene RIF (41)

AA Sequence

MRQQDAPKPTPAACRCSGLARRVLTIAFALLILGLMTWAYAAGVPLASDRYGLLAFGLYGAFLSAHLVAQ      1 - 70
SLFAYLEHRRVAAAARGPLDAATARSVALTISAYQEDPAYLRQCLASARALLYPRARLRVLMVVDGNRAE     71 - 140
DLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCVAQ    141 - 210
RWGGKREVMYTAFKALGDSVDYVQVCDSDTRLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFL    211 - 280
SSLRYWVAFNVERACQSYFHCVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMG    281 - 350
YATKYTSRSRCYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVL    351 - 420
RLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLALVTMNQSGWGT    421 - 490
SGRRKLAANYVPLLPLALWALLLLGGLVRSVAHEARADWSGPSRAAEAYHLAAGAGAYVGYWVAMLTLYW    491 - 560
VGVRRLCRRRTGGYRVQV                                                        561 - 578
//

Text Mined References (50)

PMID Year Title