Property Summary

NCBI Gene PubMed Count 48
Grant Count 151
R01 Count 73
Funding $42,777,100.05
PubMed Score 1276.69
PubTator Score 160.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -5.100 0.000
primitive neuroectodermal tumor -1.200 0.000
tuberculosis -1.200 0.001
group 3 medulloblastoma -1.200 0.000
ovarian cancer -2.900 0.000
pituitary cancer 1.300 0.000

Synonym

Accession Q92839 Q14470 Q9NS49
Symbols HAS

Gene

 GO Function (1)

Gene RIF (40)

PMID Text
26518873 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
25325984 transcriptional regulation of the HAS and HAS2-antisense RNA 1 genes, was analyzed.
24950197 The minor allele genotypes of HAS1 SNPs are significantly more frequent in MM, WM, CLL and in affected members of a monoclonal gammopathy-prone family than they are in breast cancer, sporadic MGUS or healthy donors
24658508 HAS1 is the main enzyme responsible for hyaluronan production by normal keratinocytes.
24099991 The HAS1-dependent coat is induced by inflammatory agents and glycemic stress, mediated by altered presentation of either CD44 or hyaluronan, and can offer a rapid cellular response to injury and inflammation.
23560496 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of hyaluronan synthase 1 (HAS1) in peptide-treated PBMCs
23303191 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3
23301075 aberrant intronic HAS1 splicing in multiple myeloma patients may rely on intronic HAS1 deletions and mutations that are frequent in MM patients but absent from healthy donors
23123404 TGF-beta1 up-regulation of HAS1 transcription was mediated via Smad3 but not Smad2, while HAS1 induction by IL-1beta was Sp3, not Sp1, dependent.
More...

AA Sequence

MRQQDAPKPTPAACRCSGLARRVLTIAFALLILGLMTWAYAAGVPLASDRYGLLAFGLYGAFLSAHLVAQ      1 - 70
SLFAYLEHRRVAAAARGPLDAATARSVALTISAYQEDPAYLRQCLASARALLYPRARLRVLMVVDGNRAE     71 - 140
DLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCVAQ    141 - 210
RWGGKREVMYTAFKALGDSVDYVQVCDSDTRLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFL    211 - 280
SSLRYWVAFNVERACQSYFHCVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMG    281 - 350
YATKYTSRSRCYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVL    351 - 420
RLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLALVTMNQSGWGT    421 - 490
SGRRKLAANYVPLLPLALWALLLLGGLVRSVAHEARADWSGPSRAAEAYHLAAGAGAYVGYWVAMLTLYW    491 - 560
VGVRRLCRRRTGGYRVQV                                                        561 - 578
//

Text Mined References (49)

PMID Year Title
26518873 2015 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
25325984 2015 Analysis of human hyaluronan synthase gene transcriptional regulation and downstream hyaluronan cell surface receptor mobility in myofibroblast differentiation.
24950197 2014 Inherited polymorphisms in hyaluronan synthase 1 predict risk of systemic B-cell malignancies but not of breast cancer.
24658508 2014 Hyaluronan metabolism in human keratinocytes and atopic dermatitis skin is driven by a balance of hyaluronan synthases 1 and 3.
24099991 2014 Hyaluronan synthase 1 (HAS1) produces a cytokine-and glucose-inducible, CD44-dependent cell surface coat.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23560496 2013 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23303191 2013 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3.
23301075 2013 Alteration of introns in a hyaluronan synthase 1 (HAS1) minigene convert Pre-mRNA [corrected] splicing to the aberrant pattern in multiple myeloma (MM): MM patients harbor similar changes.
23123404 Identification and analysis of the human hyaluronan synthase 1 gene promoter reveals Smad3- and Sp3-mediated transcriptional induction.
More...