Property Summary

NCBI Gene PubMed Count 30
PubMed Score 23.03
PubTator Score 23.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pituitary cancer 1972 2.3e-05
osteosarcoma 7950 2.3e-04
psoriasis 6694 6.0e-04
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.428 2.3e-04
pituitary cancer 1.400 2.3e-05
psoriasis 1.300 6.0e-04

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (16)

AA Sequence

MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAP      1 - 70
LRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSAL     71 - 140
SPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSG    141 - 210
NLIKEAVRRLHSRRLQLRAKLPQRPLLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS     211 - 279
//

Text Mined References (31)

PMID Year Title