Property Summary

NCBI Gene PubMed Count 27
Grant Count 10
R01 Count 10
Funding $492,109.03
PubMed Score 22.89
PubTator Score 23.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma -2.428 0.000
pituitary cancer 1.400 0.000

 MGI Term (1)

Gene RIF (14)

PMID Text
26178481 FRAT1 and ABCG2 overexpression is associated with carcinogenesis, progression, and poor prognosis in patients with Pancreatic ductal adenocarcinoma.
25922553 FRAT1 overexpression correlates with pathologic grade, proliferation, invasion and angiogenesis in brain gliomas.
25387569 Positive ROR2 and FRAT1 expression is associated with the progression and poor prognosis of chondrosarcoma.
24829151 The mechanism of inhibiting beta-catenin phosphorylation involves the NDRG1-mediated upregulation of the GSK3beta-binding protein FRAT1.
23613813 These results highlight the potential role of FRAT1 in tumorigenesis and progression of glioblastoma.
22528942 The overexpression of Frat1 and beta-catenin was correlated with tumor differentiation, TNM stage, lymph node metastasis, and poor prognosis of NSCLC.
21818639 Down-regulation of Frat1 expression reduced invasive ability in A549 cell line, further supporting idea that Frat1 may play crucial role in carcinogenesis, tumor invasiveness and dissemination in human lung cancer.
20096670 Our results suggest that FRAT1 may be an important factor in the tumorigenesis and progression of gliomas, and could be used as a potential molecular marker for pathological diagnosis and a target for biological therapy.
20041315 Elevated expression of FRAT1 was associated with astrocytomas.
18498136 Aberrant activation of beta-catenin/TCF pathway in esophageal cancer appears to be due to upstream events such as FRAT1 overexpression, and c-Myc may be an important element in oncogenesis of human ESCC induced by FRAT1.
More...

AA Sequence

MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAP      1 - 70
LRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSAL     71 - 140
SPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSG    141 - 210
NLIKEAVRRLHSRRLQLRAKLPQRPLLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS     211 - 279
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26178481 2015 The clinical significance of FRAT1 and ABCG2 expression in pancreatic ductal adenocarcinoma.
25922553 2015 Overexpression of FRAT1 is associated with malignant phenotype and poor prognosis in human gliomas.
25387569 2015 The clinical pathological significance of FRAT1 and ROR2 expression in cartilage tumors.
24829151 2014 The metastasis suppressor NDRG1 modulates the phosphorylation and nuclear translocation of ?-catenin through mechanisms involving FRAT1 and PAK4.
23613813 2013 Knockdown of FRAT1 expression by RNA interference inhibits human glioblastoma cell growth, migration and invasion.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
22528942 2012 Expression of Frat1 correlates with expression of ?-catenin and is associated with a poor clinical outcome in human SCC and AC.
21818639 2011 Overexpression of Frat1 correlates with malignant phenotype and advanced stage in human non-small cell lung cancer.
More...