Property Summary

NCBI Gene PubMed Count 110
PubMed Score 104.73
PubTator Score 1598.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.470 1.1e-03
active ulcerative colitis 1.399 6.4e-03
acute myeloid leukemia 1.100 2.9e-02
adult high grade glioma 1.100 2.7e-02
astrocytoma 2.100 1.3e-03
colon cancer 1.400 1.7e-02
cutaneous lupus erythematosus 1.400 7.8e-03
gastric carcinoma 1.500 2.5e-02
group 3 medulloblastoma -1.100 1.3e-03
interstitial cystitis 1.900 4.3e-03
invasive ductal carcinoma 1.082 1.2e-02
lung cancer -1.500 1.9e-04
lung carcinoma -1.900 8.8e-27
osteosarcoma -1.203 1.9e-02
subependymal giant cell astrocytoma 1.247 3.7e-02
Waldenstrons macroglobulinemia 1.006 1.7e-02

Gene RIF (58)

AA Sequence

MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEG      1 - 70
VSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESVVSPPELPPRNIPLTASSCEA     71 - 140
KEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLAQDSEFVKTGSSSLPHLK    141 - 210
KLTTLLCKELYGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVK    211 - 280
ALLHEGPESPHRPSLIPPVTFEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKS    281 - 350
QKFLNKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK    351 - 420
KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTVAIHTLWNIRI    421 - 490
VVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNIL    491 - 560
RFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVF    561 - 630
LHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSD    631 - 700
HSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEE    701 - 770
GSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH    771 - 840
GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAPPCSGSSITEI    841 - 910
INPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGESPPTPPGQPPISPKKFLPSTA    911 - 980
NRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENPLYGSLSSFPKPAPRKDQESPKMPRKEPPPC    981 - 1050
PEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKR   1051 - 1120
PIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ    1121 - 1189
//

Text Mined References (115)

PMID Year Title