Property Summary

NCBI Gene PubMed Count 103
Grant Count 119
R01 Count 84
Funding $9,608,093.45
PubMed Score 95.95
PubTator Score 1598.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.006 0.017
cutaneous lupus erythematosus 1.400 0.008
osteosarcoma -2.369 0.000
astrocytoma 2.100 0.001
colon cancer 1.400 0.017
lung cancer -1.500 0.000
active Crohn's disease 1.470 0.001
active ulcerative colitis 1.399 0.006
interstitial cystitis 1.900 0.004
adult high grade glioma 1.100 0.027
group 3 medulloblastoma -1.100 0.001
acute myeloid leukemia 1.100 0.029
subependymal giant cell astrocytoma 1.247 0.037
invasive ductal carcinoma 1.082 0.012
lung carcinoma -1.900 0.000
gastric carcinoma 1.500 0.025

Synonym

Accession Q92835 O00145 Q13544 Q13545 Q6P5A4 Q92656 Q9UE80
Symbols SHIP
SHIP1
SHIP-1
hp51CN
SIP-145
p150Ship

Gene

PANTHER Protein Class (2)

PDB

2YSX  

Gene RIF (54)

PMID Text
26683227 Loss of SHIP promotes lung inflammation and mammary tumor metastasis.
26481854 SHIP levels and activity are lower in intestinal tissues and peripheral blood samples from patients with Crohn's disease, resulting in induction of Il1-beta.
25971362 Underexpression of SHIP1 is associated with drug resistance in acute myeloid leukemia.
25723258 ectopically expressed SHIP1 accumulates in nucleolar cavities and colocalizes with the tumor suppressor protein p53.
25312647 SLAMF7-triggered inhibition is mediated by a mechanism involving Src kinases, CD45, and SHIP-1 that is defective in MM cells
25175984 Results show that expression of SHIP1 protein is targeted by miR-155 in acute myeloid leukemia (AML) suggesting it as an onco-miR. The miR-155/SHIP1/PI3K/AKT signaling pathway could play an important role in the pathogenesis of AML.
24914134 High ship1 expression is associated with chronic lymphocytic leukemia.
24708712 Overexpression of miR-155 in the gouty synovial fluid mononuclear cells leads to suppress SHIP-1 levels and enhance proinflammatory cytokines.
24522920 Based on these observations, authors conclude that miR-155 modulates the neuroinflammatory response during Japanese encephalitis virus infection via negative regulation of SHIP1 expression.
24352714 The discovery and replication studies presented here show SHIP-1 to be a risk marker for acute ischemic stroke in the Chinese population, which appears to be a novel finding.
More...

AA Sequence

MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEG      1 - 70
VSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESVVSPPELPPRNIPLTASSCEA     71 - 140
KEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLAQDSEFVKTGSSSLPHLK    141 - 210
KLTTLLCKELYGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVK    211 - 280
ALLHEGPESPHRPSLIPPVTFEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKS    281 - 350
QKFLNKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK    351 - 420
KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTVAIHTLWNIRI    421 - 490
VVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNIL    491 - 560
RFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVF    561 - 630
LHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSD    631 - 700
HSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEE    701 - 770
GSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH    771 - 840
GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAPPCSGSSITEI    841 - 910
INPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGESPPTPPGQPPISPKKFLPSTA    911 - 980
NRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENPLYGSLSSFPKPAPRKDQESPKMPRKEPPPC    981 - 1050
PEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKR   1051 - 1120
PIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ    1121 - 1189
//

Text Mined References (108)

PMID Year Title
26683227 2016 SHIP represses lung inflammation and inhibits mammary tumor metastasis in BALB/c mice.
26481854 2016 Activity of SHIP, Which Prevents Expression of Interleukin 1?, Is Reduced in Patients With Crohn's Disease.
26221972 2015 A polymorphism in a phosphotyrosine signalling motif of CD229 (Ly9, SLAMF3) alters SH2 domain binding and T-cell activation.
25971362 2015 Pharmacological targeting of miR-155 via the NEDD8-activating enzyme inhibitor MLN4924 (Pevonedistat) in FLT3-ITD acute myeloid leukemia.
25723258 2015 The tumor suppressor SHIP1 colocalizes in nucleolar cavities with p53 and components of PML nuclear bodies.
25416956 2014 A proteome-scale map of the human interactome network.
25312647 2015 Immune cell inhibition by SLAMF7 is mediated by a mechanism requiring src kinases, CD45, and SHIP-1 that is defective in multiple myeloma cells.
25175984 2014 SHIP1 is targeted by miR-155 in acute myeloid leukemia.
24914134 2014 MicroRNA-155 influences B-cell receptor signaling and associates with aggressive disease in chronic lymphocytic leukemia.
24708712 2014 MicroRNA-155 as a proinflammatory regulator via SHIP-1 down-regulation in acute gouty arthritis.
More...