Property Summary

NCBI Gene PubMed Count 56
PubMed Score 76.35
PubTator Score 48.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.600 1.4e-04
astrocytic glioma -2.800 2.2e-03
Astrocytoma, Pilocytic -2.600 1.4e-05
atypical teratoid / rhabdoid tumor -3.600 6.0e-09
ependymoma -2.600 3.0e-02
glioblastoma -2.400 8.0e-06
group 3 medulloblastoma -1.900 3.1e-02
lung cancer 4.500 2.3e-05
medulloblastoma, large-cell -3.300 5.8e-05
oligodendroglioma -1.800 4.0e-02
Pick disease -1.800 1.3e-02
pituitary cancer -1.900 1.2e-03
psoriasis -2.600 4.2e-25
subependymal giant cell astrocytoma -2.027 4.2e-02

 CSPA Cell Line (1)

Gene RIF (37)

AA Sequence

MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLFQDIEREIHAA      1 - 70
PHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEAL     71 - 140
PYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKII    141 - 210
FMPNGYITQCPNLNHTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLY    211 - 280
RDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILT    281 - 350
KSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS    351 - 420
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDEN    421 - 490
AICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSGFTGSHCEKDIDECSEGIIEC    491 - 560
HNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSC    561 - 630
SGDCPHEGGLKHNGQVWTLKEDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGH    631 - 700
KLYRSGDNWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDS    701 - 770
YGVSRLSGSVWTMAGSPCTTCKCKNGRVCCSVDFECLQNN                                  771 - 810
//

Text Mined References (58)

PMID Year Title