Property Summary

NCBI Gene PubMed Count 56
Grant Count 25
R01 Count 18
Funding $2,702,607.46
PubMed Score 66.03
PubTator Score 48.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.800 0.002
posterior fossa group A ependymoma -3.100 0.000
oligodendroglioma -1.800 0.040
glioblastoma -3.000 0.000
medulloblastoma -3.900 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.300 0.000
lung cancer 4.500 0.000
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -2.600 0.000
subependymal giant cell astrocytoma -2.027 0.042
Pick disease -1.800 0.013
pituitary cancer -1.900 0.001
psoriasis -2.600 0.000

Gene RIF (37)

PMID Text
26772960 establish the feasibility of combining NELL-1 with BMP2 to improve clinical bone regeneration and provide mechanistic insight into canonical Wnt pathway activity during NELL-1 and BMP2 osteogenesis
26700847 lipoaspirate-derived hPSCs present a novel and abundant cell source of MSCs for cartilage regeneration, and the combinatorial application of NELL-1, TGF-beta3, and BMP-6 with hPSCs may remarkably enhance and accelerate cartilage repair.
26627376 Data suggest that TSPN (N-terminal thrombospondin-1-like) domain of NELL1 exhibits major heparin-binding sites which may be involved in interaction of NELL1 with cell surface heparan sulfate proteoglycans.
26090379 We also detected lower relative expression of Nell-1 by real-time PCR. Furthermore, immunohistochemical analyses revealed that Nell-1 staining was less intense in cancer tissue relative to normal tissue and that the tumor cells had spread to the muscle
26082355 NELL-1 signaling activates Wnt/beta-catenin signaling.
25791475 NELL-1 demonstrates diffuse and reliable expression in benign but not malignant bone-forming skeletal tumors
25726761 CpG islands in the NELL1 and NELL2 promoters are hypermethylated in renal cell carcinoma.NELL1 and NELL2 protein expression is downregulated in clear cell renal carcinoma.
25220281 NELL1 overexpression greatly enhanced the osteogenic differentiation and mineral synthesis of iPSC-MSCs on RGD-grafted CPC scaffold for the first time.
23400010 Two single-nucleotide polymorphisms of the NELL1 gene may represent a novel mechanism underlying hydrochlorothiazide-induced adverse metabolic effects (meta-analysis).
23017834 Data indicate that LvNELL1 infection promoted the osteogenic differentiation of hADSCs, and the effect was comparable with that of LvBMP2.
More...

AA Sequence

MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLFQDIEREIHAA      1 - 70
PHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEAL     71 - 140
PYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKII    141 - 210
FMPNGYITQCPNLNHTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLY    211 - 280
RDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILT    281 - 350
KSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS    351 - 420
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDEN    421 - 490
AICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSGFTGSHCEKDIDECSEGIIEC    491 - 560
HNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSC    561 - 630
SGDCPHEGGLKHNGQVWTLKEDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGH    631 - 700
KLYRSGDNWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDS    701 - 770
YGVSRLSGSVWTMAGSPCTTCKCKNGRVCCSVDFECLQNN                                  771 - 810
//

Text Mined References (58)

PMID Year Title
26772960 2016 Novel Wnt Regulator NEL-Like Molecule-1 Antagonizes Adipogenesis and Augments Osteogenesis Induced by Bone Morphogenetic Protein 2.
26700847 2016 Accelerated Chondrogenic Differentiation of Human Perivascular Stem Cells with NELL-1.
26627376 2015 Mapping the heparin-binding site of the osteoinductive protein NELL1 by site-directed mutagenesis.
26090379 2015 MALDI-TOF Mass Array Analysis of Nell-1 Promoter Methylation Patterns in Human Gastric Cancer.
26082355 2015 NELL-1 in the treatment of osteoporotic bone loss.
25791475 2015 NELL-1 expression in benign and malignant bone tumors.
25726761 2015 Expression and regulatory effects on cancer cell behavior of NELL1 and NELL2 in human renal cell carcinoma.
25220281 2014 Effect of NELL1 gene overexpression in iPSC-MSCs seeded on calcium phosphate cement.
24563467 2014 Oligomerization-induced conformational change in the C-terminal region of Nel-like molecule 1 (NELL1) protein is necessary for the efficient mediation of murine MC3T3-E1 cell adhesion and spreading.
24335144 2013 Human NELL1 protein augments constructive tissue remodeling with biologic scaffolds.
More...