Property Summary

Ligand Count 3
NCBI Gene PubMed Count 232
PubMed Score 372.00
PubTator Score 390.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma 2.300 7.0e-03
Astrocytoma, Pilocytic 1.200 1.5e-04
Breast cancer -1.200 1.1e-06
colon cancer -2.400 1.4e-02
Down syndrome 1.500 6.3e-04
ductal carcinoma in situ -1.300 1.2e-04
glioblastoma multiforme 1.100 9.7e-11
group 3 medulloblastoma -1.500 2.1e-03
invasive ductal carcinoma -1.200 6.7e-04
lung adenocarcinoma -1.100 4.2e-14
lung cancer -1.500 3.3e-03
medulloblastoma, large-cell -2.600 1.0e-04
mucosa-associated lymphoid tissue lympho... 1.330 8.1e-03
non-small cell lung cancer -1.627 4.5e-24
oligodendroglioma 2.300 2.1e-03
osteosarcoma -2.336 6.9e-04
ovarian cancer -3.000 1.2e-10
pancreatic ductal adenocarcinoma liver m... -1.248 5.8e-03
posterior fossa group A ependymoma -1.200 1.7e-04
Rheumatoid arthritis 1.500 8.6e-03
spina bifida -1.664 3.1e-02

Protein-protein Interaction (7)

Gene RIF (164)

AA Sequence

MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGG      1 - 70
GSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCS     71 - 140
HALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSL    141 - 210
EKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKE    211 - 280
NYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFL    281 - 350
SMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG    351 - 420
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEER    421 - 490
RGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICF    491 - 560
RMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPK    561 - 630
TKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPI    631 - 700
ESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDL    701 - 770
KTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK            771 - 832
//

Text Mined References (238)

PMID Year Title