Property Summary

NCBI Gene PubMed Count 216
Grant Count 97
R01 Count 57
Funding $8,792,110.59
PubMed Score 357.33
PubTator Score 390.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.009
astrocytic glioma 2.300 0.007
oligodendroglioma 2.300 0.002
glioblastoma multiforme 1.100 0.000
osteosarcoma -3.265 0.000
group 3 medulloblastoma -1.500 0.002
medulloblastoma, large-cell -2.600 0.000
pancreatic ductal adenocarcinoma liver m... -1.248 0.006
non-small cell lung cancer -1.627 0.000
lung cancer -2.900 0.000
colon cancer -2.400 0.014
lung adenocarcinoma -1.100 0.000
pilocytic astrocytoma 1.900 0.000
posterior fossa group A ependymoma -1.200 0.000
spina bifida -1.664 0.031
Breast cancer -1.200 0.000
mucosa-associated lymphoid tissue lympho... 1.330 0.008
ductal carcinoma in situ -1.300 0.000
invasive ductal carcinoma -1.200 0.001
ovarian cancer -3.000 0.000
Down syndrome 1.500 0.001

Synonym

Accession Q92831 Q6NSK1
Symbols CAF
PCAF
P/CAF

Gene

PDB

1CM0   1JM4   1N72   1WUG   1WUM   1ZS5   2RNW   2RNX   3GG3   4NSQ   5FDZ   5FE0   5FE1   5FE2   5FE3   5FE4   5FE5   5FE6   5FE7   5FE8   5FE9  

Gene RIF (179)

PMID Text
26945969 low expression of PCAF in hepatocellular carcinoma tissues facilitates tumor cells migration and invasion which is achieved via Gli1-driven epithelial-mesenchymal transition phenotypes.
26728851 The Gcn5 is important for turning on genes in cancers that overexpress Myc.
26662507 Notch signaling was altered in almost half of the clear-cell renal cell carcinoma patients and copy number variances in MAML1 and KAT2B were predominant changes.
26001729 p300HAT activated by p38MAPK plays a pivotal role in regulating the expression of prosurvival molecules following photodynamic therapy.
25855960 Results show that PCAF can induce cell apoptosis by modulating a GLI1/Bcl-2/BAX axis that in turn suppresses HCC progression.
25800736 identified that PCAF interacts with and acetylates EZH2 mainly at lysine 348
25731772 Acetylation of HIV-1 Tat by P/CAF at Lys28 and binding of P/CAF to Lys50 acetylated Tat regulates Tat binding to cyclin T1 and HIV-1 TAR RNA, as well as Tat-mediated transactivation of the HIV-1 LTR promoter, by allowing Tat to dissociate from TAR RNA
25731772 Acetylation of HIV-1 Tat by P/CAF at Lys28 and binding of P/CAF to Lys50 acetylated Tat regulates Tat binding to cyclin T1 and HIV-1 TAR RNA, as well as Tat-mediated transactivation of the HIV-1 LTR promoter, by allowing Tat to dissociate from TAR RNA
25731772 Acetylation of HIV-1 Tat by P/CAF at Lys28 and binding of P/CAF to Lys50 acetylated Tat regulates Tat binding to cyclin T1 and HIV-1 TAR RNA, as well as Tat-mediated transactivation of the HIV-1 LTR promoter, by allowing Tat to dissociate from TAR RNA
25707758 CBP and p300 as lysine acetyltransferases responsible for the regulation of MR
More...

AA Sequence

MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGG      1 - 70
GSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCS     71 - 140
HALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSL    141 - 210
EKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKE    211 - 280
NYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFL    281 - 350
SMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG    351 - 420
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEER    421 - 490
RGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICF    491 - 560
RMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPK    561 - 630
TKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPI    631 - 700
ESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDL    701 - 770
KTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK            771 - 832
//

Text Mined References (221)

PMID Year Title
26945969 2016 PCAF inhibits hepatocellular carcinoma metastasis by inhibition of epithelial-mesenchymal transition by targeting Gli-1.
26728851 2016 Sharon Dent: The unfolding SAGA of chromatin-modifying proteins.
26662507 Genetic alteration in notch pathway is associated with better prognosis in renal cell carcinoma.
26001729 2015 Histone acetyltransferase p300 is induced by p38MAPK after photodynamic therapy: the therapeutic response is increased by the p300HAT inhibitor anacardic acid.
25855960 2015 Histone acetyltransferase PCAF accelerates apoptosis by repressing a GLI1/BCL2/BAX axis in hepatocellular carcinoma.
25800736 2015 PCAF-primed EZH2 acetylation regulates its stability and promotes lung adenocarcinoma progression.
25707758 2015 Lysine acetyltransferases cyclic adenosine monophosphate response element-binding binding protein and acetyltransferase p300 attenuate transcriptional activity of the mineralocorticoid receptor through its acetylation.
25501279 2015 PCAF-mediated Akt1 acetylation enhances the proliferation of human glioblastoma cells.
25426559 2015 GCN5 inhibits XBP-1S-mediated transcription by antagonizing PCAF action.
25269644 2014 Gcn5 and PCAF negatively regulate interferon-? production through HAT-independent inhibition of TBK1.
More...