Property Summary

NCBI Gene PubMed Count 76
Grant Count 275
R01 Count 217
Funding $28,238,689.88
PubMed Score 258.21
PubTator Score 146.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.400 0.006
psoriasis 1.100 0.001
pancreatic ductal adenocarcinoma liver m... 1.244 0.008
lung adenocarcinoma 1.600 0.000

Synonym

Accession Q92830 Q8N1A2 Q9UCW1
Symbols GCN5
hGCN5
GCN5L2
PCAF-b

Gene

PDB

1F68   1Z4R   3D7C   5H84   5H86  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
504327 confirmatory 817 / 10134 / 376634 qHTS Assay for Inhibitors of GCN5L2
504398 summary 0 / 0 / 0 qHTS Assay for Inhibitors of GCN5L2: Summary
588347 confirmatory 96 / 49 / 0 qHTS Assay for Inhibitors of GCN5L2: Hit confirmation

Gene RIF (71)

PMID Text
27022023 Methionine was the only essential amino acid that rapidly induced PGC-1alpha acetylation through activating the GCN5 acetyltransferase.
27005833 Data uncover GCN5 as a negative regulator of C/EBPalpha and demonstrate the importance of C/EBPalpha acetylation in myeloid differentiation.
26637399 GCN5 plays a positive role in human colon cancer development, and its suppression holds a great therapeutic potential in antitumor therapy
26546801 Acetyltransferase p300 collaborates with chromodomain helicase DNA-binding protein 4 (CHD4) to facilitate DNA double-strand break repair
26468280 results thus demonstrate that the catalytic activity of GCN5 is stimulated by subunits of the ADA2a- or ADA2b-containing HAT modules and is further increased by incorporation of the distinct HAT modules in the ATAC or SAGA holo-complexes
26420353 these results may point to the GCN5-NF-kappaB pathway as a novel potential molecular target for stem cell mediated regenerative medicine and the treatment of metabolic bone diseases such as osteoporosis.
26378521 GCN5 Potentiates Glioma Proliferation and Invasion via STAT3 and AKT Signaling Pathways
26256950 Suggest lysine acetyltransfer as a potential regulator of platelet actin dynamics, and potential roles for lysine acetylation in the molecular coordination of platelet activation and function.
25770212 DDIT3 and KAT2A cooperatively up-regulate TNFRSF10A and TNFRSF10B.
25707573 The antifibrotic effects of SIRT1 in systemic sclerosis were due in part to decreased expression and function of the acetyltransferase p300.
More...

AA Sequence

MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGA      1 - 70
GSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPA     71 - 140
ANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCIL    141 - 210
QMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRS    211 - 280
QAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRT    281 - 350
LILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS    351 - 420
LDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETA    421 - 490
RLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVI    491 - 560
GGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKD    561 - 630
IKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGV    631 - 700
RQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIR    701 - 770
FPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK       771 - 837
//

Text Mined References (81)

PMID Year Title
27022023 2016 The Methionine Transamination Pathway Controls Hepatic Glucose Metabolism through Regulation of the GCN5 Acetyltransferase and the PGC-1? Transcriptional Coactivator.
27005833 2016 Acetylation of C/EBP? inhibits its granulopoietic function.
26637399 2015 The Histone Acetyltransferase GCN5 Expression Is Elevated and Regulated by c-Myc and E2F1 Transcription Factors in Human Colon Cancer.
26546801 2016 Acetyltransferase p300 collaborates with chromodomain helicase DNA-binding protein 4 (CHD4) to facilitate DNA double-strand break repair.
26468280 2015 Subunits of ADA-two-A-containing (ATAC) or Spt-Ada-Gcn5-acetyltrasferase (SAGA) Coactivator Complexes Enhance the Acetyltransferase Activity of GCN5.
26420353 2016 Histone Acetyltransferase GCN5 Regulates Osteogenic Differentiation of Mesenchymal Stem Cells by Inhibiting NF-?B.
26378521 2015 GCN5 Potentiates Glioma Proliferation and Invasion via STAT3 and AKT Signaling Pathways.
26256950 2015 Lysine acetyltransfer supports platelet function.
25770212 2015 DDIT3 and KAT2A Proteins Regulate TNFRSF10A and TNFRSF10B Expression in Endoplasmic Reticulum Stress-mediated Apoptosis in Human Lung Cancer Cells.
25707573 2015 The Histone Deacetylase Sirtuin 1 Is Reduced in Systemic Sclerosis and Abrogates Fibrotic Responses by Targeting Transforming Growth Factor ? Signaling.
More...