Property Summary

NCBI Gene PubMed Count 84
Grant Count 32
R01 Count 15
Funding $5,020,359.82
PubMed Score 114.61
PubTator Score 127.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.453 0.004
atypical teratoid / rhabdoid tumor 1.300 0.021
active Crohn's disease 1.104 0.042
interstitial cystitis -1.100 0.000
inflammatory breast cancer 1.500 0.016
psoriasis 3.200 0.000

Gene RIF (76)

PMID Text
26841725 Recent studies have shown that HOXB13 is a strong candidate for familial Prostate cancer gene.
26728744 The Breast Cancer Index (BCI) is a continuous risk index model of two previously described biomarkers: molecular grade index (MGI) and HOXB13:IL17BR (H:I) ratio
26709644 review the functions attributed to HOXB13, by highlighting the most recent findings supporting the hypothesis that HOXB13 might serve as a novel biomarker for the prognosis of prostate cancer
26638190 The strongest predictors are the BRCA2 mutations, and the highly penetrant G84E mutation in HOXB13
26590121 We showed for the first time that HOXB13 is a sensitive and specific marker for detection of prostatic origin in distant metastases.
26517352 Studies indicate that the germline homeo box B13 protein (HOXB13) p.Gly84Glu mutation is significantly increased the risk of cancers.
26457646 Data show that transcription factor FOXA1 and homeodomain protein HOXB13 colocalize with androgen receptor (AR) at tumor-specific AR binding sites.
26261579 Hoxb-13 overexpression is correlated with tumor angiogenesis, aberrant expression of EMT-associated markers and aggressive clinicopathological characteristics in pancreatic carcinoma.
26200506 P63 and HOXB13 is helpful in resolving the diagnosis.
26176944 The prevalence of somatic HOXB13 mutations in prostate cancer.
More...

AA Sequence

MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVP      1 - 70
QGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPM     71 - 140
ASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDA    141 - 210
CAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKN    211 - 280
SATP                                                                      281 - 284
//

Text Mined References (85)

PMID Year Title
26841725 2016 Regulating NKX3.1 stability and function: Post-translational modifications and structural determinants.
26728744 2016 Assessment of the prognostic and predictive utility of the Breast Cancer Index (BCI): an NCIC CTG MA.14 study.
26709644 2016 Hoxb13, a potential prognostic biomarker for prostate cancer.
26638190 2016 Screening for familial and hereditary prostate cancer.
26590121 2016 HOXB13 as an immunohistochemical marker of prostatic origin in metastatic tumors.
26517352 2015 Germline HOXB13 p.Gly84Glu mutation and cancer susceptibility: a pooled analysis of 25 epidemiological studies with 145,257 participates.
26457646 2015 The androgen receptor cistrome is extensively reprogrammed in human prostate tumorigenesis.
26261579 2015 Overexpression of homeobox B-13 correlates with angiogenesis, aberrant expression of EMT markers, aggressive characteristics and poor prognosis in pancreatic carcinoma.
26200506 2015 Do HOXB13 and P63 have a role in differentiating poorly differentiated prostatic carcinoma from urothelial high-grade carcinoma?
26176944 2015 Identification of Two Novel HOXB13 Germline Mutations in Portuguese Prostate Cancer Patients.
More...