Property Summary

NCBI Gene PubMed Count 92
PubMed Score 122.19
PubTator Score 127.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.104 4.2e-02
atypical teratoid / rhabdoid tumor 1.300 2.1e-02
inflammatory breast cancer 1.500 1.6e-02
interstitial cystitis -1.100 2.0e-04
osteosarcoma 1.453 3.9e-03
psoriasis 3.200 3.4e-19

Gene RIF (83)

AA Sequence

MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVP      1 - 70
QGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPM     71 - 140
ASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDA    141 - 210
CAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKN    211 - 280
SATP                                                                      281 - 284
//

Text Mined References (94)

PMID Year Title