Property Summary

Ligand Count 6
NCBI Gene PubMed Count 72
PubMed Score 751.24
PubTator Score 369.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Melanoma 711 0.0 0.5

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.100 2.7e-02
Atopic dermatitis -1.100 1.3e-02
breast carcinoma -1.400 1.7e-03
dermatomyositis 1.500 1.1e-02
ductal carcinoma in situ -1.200 4.3e-02
gastric carcinoma 2.400 3.5e-03
glioblastoma multiforme 1.300 1.0e-12
head and neck cancer -1.100 4.0e-02
intraductal papillary-mucinous neoplasm ... 1.900 9.0e-03
invasive ductal carcinoma -2.600 9.7e-04
lung cancer -2.100 7.2e-05
malignant mesothelioma -1.400 1.0e-05
medulloblastoma, large-cell -1.800 2.8e-02
nasopharyngeal carcinoma -1.700 2.1e-07
osteosarcoma -1.784 2.7e-02
ovarian cancer -3.200 4.8e-09
pituitary cancer -1.100 4.0e-02
posterior fossa group B ependymoma 1.100 7.9e-05
psoriasis -1.100 2.9e-03
Rheumatoid arthritis 1.400 4.8e-02
spina bifida -1.641 3.4e-02

Gene RIF (34)

AA Sequence

MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFINIGQIGALKD      1 - 70
YYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCS     71 - 140
DNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNEN    141 - 210
KHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKT    211 - 280
VDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEE    281 - 350
CSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR    351 - 420
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIRPNSAVRSIYK    421 - 490
ASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCW    491 - 560
GERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPYSPTNEFPKVERFRYSRVEDPTDDYGTE    561 - 630
DYAGPCDPECSEVGCDGPGPDHCNDCLHYYYKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSH    631 - 700
GDQCMSCKYGYFLNEETNSCVTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVS    701 - 770
CEDGRYFNGQDCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI    771 - 840
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQTCEASCAKCQGPTQEDCTTCPMTR    841 - 910
IFDDGRCVSNCPSWKFEFENQCHPCHHTCQRCQGSGPTHCTSCGADNYGREHFLYQGECGDSCPEGHYAT    911 - 980
EGNTCLPCPDNCELCHSVHVCTRCMKGYFIAPTNHTCQKLECGQGEVQDPDYEECVPCEEGCLGCSLDDP    981 - 1050
GTCTSCAMGYYRFDHHCYKTCPEKTYSEEVECKACDSNCGSCDQNGCYWCEEGFFLLGGSCVRKCGPGFY   1051 - 1120
GDQEMGECESCHRACETCTGPGHDECSSCQEGLQLLRGMCVHATKTQEEGKFWNDILRKLQPCHSSCKTC   1121 - 1190
NGSATLCTSCPKGAYLLAQACVSSCPQGTWPSVRSGSCENCTEACAICSGADLCKKCQMQPGHPLFLHEG   1191 - 1260
RCYSKCPEGSYAEDGICERCSSPCRTCEGNATNCHSCEGGHVLHHGVCQENCPERHVAVKGVCKHCPEMC   1261 - 1330
QDCIHEKTCKECTPEFFLHDDMCHQSCPRGFYADSRHCVPCHKDCLECSGPKADDCELCLESSWVLYDGL   1331 - 1400
CLEECPAGTYYEKETKECRDCHKSCLTCSSSGTCTTCQKGLIMNPRGSCMANEKCSPSEYWDEDAPGCKP   1401 - 1470
CHVKCFHCMGPAEDQCQTCPMNSLLLNTTCVKDCPEGYYADEDSNRCAHCHSSCRTCEGRHSRQCHSCRP   1471 - 1540
GWFQLGKECLLQCREGYYADNSTGRCERCNRSCKGCQGPRPTDCLSCDRFFFLLRSKGECHRSCPDHYYV   1541 - 1610
EQSTQTCERCHPTCDQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKG   1611 - 1680
PGAKNCTLCPANLVLHMDDSHCLHCCNTSDPPSAQECCDCQDTTDECILRTSKVRPATEHFKTALFITSS   1681 - 1750
MMLVLLLGAAVVVWKKSRGRVQPAAKAGYEKLADPNKSYSSYKSSYRESTSFEEDQVIEYRDRDYDEDDD   1751 - 1820
DDIVYMGQDGTVYRKFKYGLLDDDDIDELEYDDESYSYYQ                                 1821 - 1860
//

Text Mined References (75)

PMID Year Title