Property Summary

NCBI Gene PubMed Count 70
Grant Count 24
R01 Count 19
Funding $2,482,158.24
PubMed Score 697.23
PubTator Score 369.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.048
malignant mesothelioma -1.800 0.000
psoriasis -1.100 0.003
glioblastoma multiforme 1.300 0.000
osteosarcoma -2.087 0.009
astrocytoma 1.100 0.027
medulloblastoma, large-cell -1.800 0.028
Atopic dermatitis -1.500 0.002
intraductal papillary-mucinous neoplasm ... 1.900 0.009
lung cancer -2.100 0.000
breast carcinoma -1.400 0.002
posterior fossa group B ependymoma 1.100 0.000
nasopharyngeal carcinoma -1.700 0.000
spina bifida -1.641 0.034
gastric carcinoma 2.400 0.004
ductal carcinoma in situ -1.200 0.043
invasive ductal carcinoma -2.600 0.001
ovarian cancer -3.200 0.000
pituitary cancer -1.100 0.040
dermatomyositis 1.500 0.011
head and neck cancer -1.100 0.040

Gene RIF (34)

PMID Text
26077903 full-length alpha-DG in the human endometrial epithelium is a barrier for embryo attachment and that removal of alpha-DG-N by proprotein convertase 5/6 (PC6; a protease critical for implantation
26055999 Case Report: whole exome sequencing of a case with the VACTERL association uncovered a novel frameshift mutation in the PCSK5 gene.
25429785 Proprotein convertase 5/6 cleaves PDGFA in the human endometrium in preparation for embryo implantation.
25350918 PC5/6A is involved in squamous differentiation of human nasal epithelial cells, possibly through up-regulation of the BMP-2 signaling pathway.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of proprotein convertase subtilisin/kexin type 5 (PCSK5) in primary human brain microvascular endothelial cells
23686857 overexpression of PCs, furin and PC5, but not PC7, which are all expressed in SMC, increase PKGI cleavage in a dose-dependent manner
22740495 study implicates PC6 as a key regulatory protein essential for the attachment of the blastocyst to the endometrial epithelium through the processing of pro-integrin-alphas
21971156 PC6 plays a key role in regulating fundamental cellular remodeling processes, such as plasma membrane transformation and membrane-cytoskeletal interface reorganization.
21700711 Latent transforming growth factor beta-binding proteins-2 and -3 inhibit the proprotein convertase 5/6A.
21273245 PC6 may have a role in uterine receptivity and its uterine lavage levels appear to be significantly lower in a subgroup of women with unexplained infertility
More...

AA Sequence

MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFINIGQIGALKD      1 - 70
YYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCS     71 - 140
DNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNEN    141 - 210
KHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKT    211 - 280
VDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEE    281 - 350
CSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR    351 - 420
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIRPNSAVRSIYK    421 - 490
ASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCW    491 - 560
GERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPYSPTNEFPKVERFRYSRVEDPTDDYGTE    561 - 630
DYAGPCDPECSEVGCDGPGPDHCNDCLHYYYKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSH    631 - 700
GDQCMSCKYGYFLNEETNSCVTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVS    701 - 770
CEDGRYFNGQDCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI    771 - 840
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQTCEASCAKCQGPTQEDCTTCPMTR    841 - 910
IFDDGRCVSNCPSWKFEFENQCHPCHHTCQRCQGSGPTHCTSCGADNYGREHFLYQGECGDSCPEGHYAT    911 - 980
EGNTCLPCPDNCELCHSVHVCTRCMKGYFIAPTNHTCQKLECGQGEVQDPDYEECVPCEEGCLGCSLDDP    981 - 1050
GTCTSCAMGYYRFDHHCYKTCPEKTYSEEVECKACDSNCGSCDQNGCYWCEEGFFLLGGSCVRKCGPGFY   1051 - 1120
GDQEMGECESCHRACETCTGPGHDECSSCQEGLQLLRGMCVHATKTQEEGKFWNDILRKLQPCHSSCKTC   1121 - 1190
NGSATLCTSCPKGAYLLAQACVSSCPQGTWPSVRSGSCENCTEACAICSGADLCKKCQMQPGHPLFLHEG   1191 - 1260
RCYSKCPEGSYAEDGICERCSSPCRTCEGNATNCHSCEGGHVLHHGVCQENCPERHVAVKGVCKHCPEMC   1261 - 1330
QDCIHEKTCKECTPEFFLHDDMCHQSCPRGFYADSRHCVPCHKDCLECSGPKADDCELCLESSWVLYDGL   1331 - 1400
CLEECPAGTYYEKETKECRDCHKSCLTCSSSGTCTTCQKGLIMNPRGSCMANEKCSPSEYWDEDAPGCKP   1401 - 1470
CHVKCFHCMGPAEDQCQTCPMNSLLLNTTCVKDCPEGYYADEDSNRCAHCHSSCRTCEGRHSRQCHSCRP   1471 - 1540
GWFQLGKECLLQCREGYYADNSTGRCERCNRSCKGCQGPRPTDCLSCDRFFFLLRSKGECHRSCPDHYYV   1541 - 1610
EQSTQTCERCHPTCDQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKG   1611 - 1680
PGAKNCTLCPANLVLHMDDSHCLHCCNTSDPPSAQECCDCQDTTDECILRTSKVRPATEHFKTALFITSS   1681 - 1750
MMLVLLLGAAVVVWKKSRGRVQPAAKAGYEKLADPNKSYSSYKSSYRESTSFEEDQVIEYRDRDYDEDDD   1751 - 1820
DDIVYMGQDGTVYRKFKYGLLDDDDIDELEYDDESYSYYQ                                 1821 - 1860
//

Text Mined References (73)

PMID Year Title
26077903 2015 Posttranslational removal of ?-dystroglycan N terminus by PC5/6 cleavage is important for uterine preparation for embryo implantation in women.
26055999 2015 PCSK5 mutation in a patient with the VACTERL association.
25429785 2015 Proprotein convertase 5/6 cleaves platelet-derived growth factor A in the human endometrium in preparation for embryo implantation.
25416956 2014 A proteome-scale map of the human interactome network.
25350918 2015 Proprotein convertase 5/6a is associated with bone morphogenetic protein-2-induced squamous cell differentiation.
24252756 2013 Proprotein convertases in high-density lipoprotein metabolism.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23686857 2013 Proprotein convertases play an important role in regulating PKGI endoproteolytic cleavage and nuclear transport.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23409034 2013 Alterations in gene expression of proprotein convertases in human lung cancer have a limited number of scenarios.
More...