Property Summary

Ligand Count 2
NCBI Gene PubMed Count 65
PubMed Score 259.67
PubTator Score 118.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 2.509 4.6e-06
astrocytic glioma -1.200 1.8e-02
atypical teratoid/rhabdoid tumor 1.300 4.0e-04
Endometriosis 1.663 1.6e-02
ependymoma 1.400 1.5e-06
group 3 medulloblastoma 1.200 2.9e-02
intraductal papillary-mucinous adenoma (... -1.700 6.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.3e-02
invasive ductal carcinoma 1.500 1.5e-02
lung cancer 7.000 2.6e-08
malignant mesothelioma -1.800 1.3e-07
Multiple myeloma 1.890 4.4e-02
nephrosclerosis -1.403 2.4e-02
non-small cell lung cancer 2.151 3.2e-18
ovarian cancer 2.000 2.3e-03
pancreatic ductal adenocarcinoma liver m... -3.310 5.5e-04
pituitary cancer 1.300 3.1e-03
psoriasis 2.000 1.7e-09
ulcerative colitis -1.332 1.4e-02

Protein-protein Interaction (8)

Gene RIF (50)

AA Sequence

MASPGCLLCVLGLLLCGAASLELSRPHGDTAKKPIIGILMQKCRNKVMKNYGRYYIAASYVKYLESAGAR      1 - 70
VVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEEL     71 - 140
SLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKL    141 - 210
KKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEAR    211 - 280
KNNHHFKSESEEEKALIYQFSPIYTGNISSFQQCYIFD                                    281 - 318
//

Text Mined References (68)

PMID Year Title