Property Summary

NCBI Gene PubMed Count 61
PubMed Score 256.08
PubTator Score 118.07

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.81611195903786E-18
non-small cell lung cancer 2798 3.19244563708425E-18
lung cancer 4473 2.59050910056631E-8
posterior fossa group A ependymoma 1511 6.19373621497459E-8
malignant mesothelioma 3163 1.30005675134642E-7
adrenocortical carcinoma 1427 4.58475872157143E-6
atypical teratoid/rhabdoid tumor 1095 4.04283260014927E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 5.49478830290629E-4
ovarian cancer 8492 0.0022503612200866
pituitary cancer 1972 0.00313078537928406
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0061589220588246
ulcerative colitis 2087 0.0138771934824209
invasive ductal carcinoma 2950 0.0145672199833132
Endometriosis 535 0.016213294370174
astrocytic glioma 2241 0.0184355638171181
nephrosclerosis 329 0.0238799853381103
group 3 medulloblastoma 2254 0.0293000556649223
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0428716286689473
Multiple myeloma 1328 0.0440605425563203
Disease Target Count Z-score Confidence
Tropical sprue 5 4.824 2.4
Cancer 2346 3.035 1.5



Accession Q92820
Symbols GH



PANTHER Protein Class (3)



  Ortholog (9)

Gene RIF (46)

26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
25823786 This study shows that polymorphisms on genes related to the metabolic pathway of pemetrexed, especially, ATIC and GGH genes, would have a therapeutic implication in pemetrexed-treated patients with lung adenocarcinoma
24908438 Polymorphism of GGH rs3758149 C>T is associated with response to therapy in acute lymphoblastic leukemia.
24447348 An interaction term, between FPGS rs7033913 heterozygotes and GGH rs11988534 homozygotes for the minor allele, had a p-value <0.0001 and may contribute to metotrexate toxicity in rheumatoid arthritis.
23374458 Suggest that GGH may serve as a potential biomarker of unfavorable clinical outcomes over short-term follow-up in breast cancer.
23107767 The results of our study suggested the potential interest of GGH -401C>T as a predictive factor of the outcome of cervical carcinoma treated with cisplatin-based chemoradiotherapy.
22994778 Genotyping of DHFR 829C>T and GGH -401C>T was performed using a polymerase chain reaction.
22763757 GG genotype of GGH -354 T > G polymorphism may have high predictive value for myelosuppression in methotrexate treated rheumatoid arthritis patients.
22678806 There was no significant difference in gamma-glutamyl hydrolase genotype or T allele frequency between the two groups (P> 0.05).
22649255 a SNP in the GGH gene remained associated with reduced CVD risk, with a stronger association in early onset CVD cases.

AA Sequence

KNNHHFKSESEEEKALIYQFSPIYTGNISSFQQCYIFD                                    281 - 318

Text Mined References (64)

PMID Year Title
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
25823786 2015 Correlation of genetic polymorphisms with clinical outcomes in pemetrexed-treated advanced lung adenocarcinoma patients.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24908438 2014 Influence of genetic polymorphisms of FPGS, GGH, and MTHFR on serum methotrexate levels in Chinese children with acute lymphoblastic leukemia.
24447348 Folic acid pathway single nucleotide polymorphisms associated with methotrexate significant adverse events in United States veterans with rheumatoid arthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23374458 2013 High levels of ?-glutamyl hydrolase (GGH) are associated with poor prognosis and unfavorable clinical outcomes in invasive breast cancer.
23107767 2013 The impact of GGH -401C>T polymorphism on cisplatin-based chemoradiotherapy response and survival in cervical cancer.