Property Summary

NCBI Gene PubMed Count 82
PubMed Score 287.44
PubTator Score 328.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 2.200 1.5e-05
astrocytic glioma 1.600 5.3e-03
Astrocytoma, Pilocytic 3.000 4.4e-09
atypical teratoid / rhabdoid tumor 1.600 3.7e-02
cystic fibrosis 2.435 2.4e-06
ependymoma 1.900 4.4e-06
glioblastoma 2.400 6.1e-08
lung carcinoma -1.800 1.4e-06
malignant mesothelioma -3.400 4.3e-08
medulloblastoma, large-cell 1.300 3.1e-03
non diabetic and post-ischemic heart fai... -1.300 1.7e-03
non-small cell lung cancer -1.296 7.5e-08
osteosarcoma 2.854 8.0e-03
ovarian cancer 1.800 3.9e-03
primitive neuroectodermal tumor 1.600 6.2e-03
type II diabetes mellitus and post-ische... -1.200 2.9e-02

 GO Function (1)

Gene RIF (75)

AA Sequence

MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQSLFAFLEHRK      1 - 70
MKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGR     71 - 140
DKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQV    141 - 210
CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCI    211 - 280
SGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQ    281 - 350
QTRWSKSYFREWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK    351 - 420
SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIPVSVWFTILLG    421 - 490
GVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRRKKGQQYDMVLDV            491 - 552
//

Text Mined References (82)

PMID Year Title