Property Summary

NCBI Gene PubMed Count 71
Grant Count 107
R01 Count 57
Funding $15,553,603.25
PubMed Score 267.31
PubTator Score 328.44

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92819 Q32MM3
Symbols

Gene

 GO Function (1)

Gene RIF (64)

PMID Text
26722395 HAS2-HA system influences the biological characteristics of human breast cancer cells
26518873 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
25325984 transcriptional regulation of the HAS and HAS2-antisense RNA 1 genes, was analyzed.
25264594 mir-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging.
25251750 Our study identified HAS2 as a novel candidate gene for susceptibility to adult asthma.
25081531 review of the roles of HAS2 and CD44 in breast tumorigenesis [review]
24847057 UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2.
24558368 HAS2 may be involved in the etiology of non-syndromic VSD and have the vital function in the development of heart septum
24527698 In contrast to other carcinoma subtypes, HAS2 expression was observed in up to 72.7% of metaplastic carcinomas of breast, a carcinoma subtype related to the epithelial-mesenchymal transition.
24472738 Stimulation with LPS caused rapid increases in versican mRNA and protein, a rapid increase in Has1 mRNA, and concomitant inhibition of hyaluronidases 1 and 2, the major hyaluronan degrading enzymes
More...

AA Sequence

MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQSLFAFLEHRK      1 - 70
MKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGR     71 - 140
DKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQV    141 - 210
CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCI    211 - 280
SGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQ    281 - 350
QTRWSKSYFREWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK    351 - 420
SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIPVSVWFTILLG    421 - 490
GVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRRKKGQQYDMVLDV            491 - 552
//

Text Mined References (71)

PMID Year Title
26722395 2015 Hyaluronan synthase 2 overexpression is correlated with the tumorigenesis and metastasis of human breast cancer.
26518873 2015 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
25325984 2015 Analysis of human hyaluronan synthase gene transcriptional regulation and downstream hyaluronan cell surface receptor mobility in myofibroblast differentiation.
25264594 2015 miR-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging.
25251750 2014 Genomewide association study identifies HAS2 as a novel susceptibility gene for adult asthma in a Japanese population.
25081531 2014 HAS2 and CD44 in breast tumorigenesis.
24847057 2014 Extracellular UDP-glucose activates P2Y14 Receptor and Induces Signal Transducer and Activator of Transcription 3 (STAT3) Tyr705 phosphorylation and binding to hyaluronan synthase 2 (HAS2) promoter, stimulating hyaluronan synthesis of keratinocytes.
24558368 2014 A novel mutation of Hyaluronan synthase 2 gene in Chinese children with ventricular septal defect.
24527698 2014 Differential expression of hyaluronan synthase 2 in breast carcinoma and its biological significance.
24472738 2014 A rapid increase in macrophage-derived versican and hyaluronan in infectious lung disease.
More...