Property Summary

NCBI Gene PubMed Count 106
PubMed Score 368.56
PubTator Score 193.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia 1.600 4.4e-02
adrenocortical carcinoma -1.198 2.6e-04
adult high grade glioma -1.900 8.7e-03
astrocytic glioma -1.700 2.0e-02
Astrocytoma, Pilocytic -2.000 8.2e-04
atypical teratoid / rhabdoid tumor -2.500 2.9e-04
colon cancer 2.200 3.1e-03
ductal carcinoma in situ 1.200 4.4e-02
ependymoma -1.900 1.6e-02
fibroadenoma 3.500 2.3e-03
glioblastoma -2.000 1.7e-05
group 3 medulloblastoma -3.100 2.3e-03
interstitial lung disease 2.600 5.7e-04
intraductal papillary-mucinous adenoma (... -2.400 5.2e-03
intraductal papillary-mucinous carcinoma... -2.800 2.4e-03
intraductal papillary-mucinous neoplasm ... -2.600 2.3e-02
lung adenocarcinoma 1.100 1.1e-05
lung cancer 3.700 9.0e-05
lung carcinoma 5.200 3.9e-34
malignant mesothelioma -5.400 3.7e-09
medulloblastoma, large-cell -3.000 3.5e-03
non-small cell lung cancer 1.257 2.0e-08
oligodendroglioma -1.500 5.7e-03
osteosarcoma 3.881 1.2e-03
pancreatic cancer 1.200 1.6e-03
Pick disease -1.100 5.8e-03
primitive neuroectodermal tumor -2.200 4.6e-02
psoriasis 2.000 2.1e-08
pterygium 1.100 1.2e-02
ulcerative colitis 1.400 4.1e-04

 GWAS Trait (1)

Gene RIF (112)

AA Sequence

MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLD      1 - 70
AYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERPLVVNFGSATUPPFTSQL     71 - 140
PAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRV    141 - 210
VADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG           211 - 273
//

Text Mined References (108)

PMID Year Title