Property Summary

NCBI Gene PubMed Count 103
Grant Count 39
R01 Count 22
Funding $7,508,412.58
PubMed Score 149.14
PubTator Score 193.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (109)

PMID Text
26588490 the reduction of SAT DIO2 expression is negatively correlated with DBP and TG levels that are associated with the MetS. This might have an effect on developing MetS.
26284425 conversion of T4 to T3 by D2 is required for TRalpha1/PI3K-mediated nongenomic actions of T4 in HUVECs, including stimulation of Akt phosphorylation and Rac activation, which result in cell migration.
26207529 In subjects who are alcohol dependent, the rs225014 DIO2 gene was associated with significant differences in the amount of naturalistic alcohol drinking.
26125736 DIO2 gene polymorphisms may play a role in the incidence of MCI in male patients.
26098717 DIO2 gene plays a role in the etiology of recurrent depressive disorder.Association of the DIO2 gene single nucleotide polymorphisms with recurrent depressive disorder.
25569702 Ala92-D2 accumulates in the Golgi, where its presence and/or ensuing oxidative stress disrupts basic cellular functions and increases pre-apoptosis.
25306702 Molecular genetic markers of predisposition to the development of thyroid disease are: GG genotype and allele G gene DIO2 (274A > G), CT and CC genotypes of the gene CYP1A1 (-3798T > C), associated with the development of nodular goiter
25304215 Thyroid hormone deiodinases D1, D2, and D3 are differentially expressed in endothelial cells following thyroid hormone exposure.
25140401 Identification of two heterozygous nonsynonymous mutations in the thyroid hormone activating type 2 deiodinase.
25105294 The rs225017 polymorphism in the 3'UTR of the human DIO2 gene is associated with increased insulin resistance.
More...

AA Sequence

MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLD      1 - 70
AYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERPLVVNFGSATUPPFTSQL     71 - 140
PAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRV    141 - 210
VADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG           211 - 273
//

Text Mined References (105)

PMID Year Title
26588490 2016 Subcutaneous Adipose Tissue Type II Deiodinase Gene Expression Reduced in Obese Individuals with Metabolic Syndrome.
26284425 2015 Type 2 Iodothyronine Deiodinase Activity Is Required for Rapid Stimulation of PI3K by Thyroxine in Human Umbilical Vein Endothelial Cells.
26207529 2015 Effect of Functionally Significant Deiodinase Single Nucleotide Polymorphisms on Drinking Behavior in Alcohol Dependence: An Exploratory Investigation.
26125736 2015 Type II deiodinase polymorphisms and serum thyroid hormone levels in patients with mild cognitive impairment.
26098717 2015 Association of the DIO2 gene single nucleotide polymorphisms with recurrent depressive disorder.
25569702 2015 Prevalent polymorphism in thyroid hormone-activating enzyme leaves a genetic fingerprint that underlies associated clinical syndromes.
25306702 [DIO2, TPO, CYP1A1 AND CYP1A2 gene polymorphism in women with thyroid disease].
25304215 2015 Thyroid hormone deiodinases D1, D2, and D3 are expressed in human endothelial dermal microvascular line: effects of thyroid hormones.
25140401 2014 Functional analysis of novel genetic variation in the thyroid hormone activating type 2 deiodinase.
25105294 2014 The rs225017 polymorphism in the 3'UTR of the human DIO2 gene is associated with increased insulin resistance.
More...