Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.84
PubTator Score 16.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.405 0.000
astrocytoma 1.100 0.004
ovarian cancer -1.500 0.000

Synonym

Accession Q92805 Q5T164 Q8IYZ9
Symbols golgin-97

Gene

Gene RIF (8)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with golgin A1 (GOLGA1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20610657 FIP1/RCP binding to Golgin-97 is required for tethering and fusion of recycling endosome-derived retrograde transport vesicles to the trans-Golgi network.
20583170 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17276477 Using RNA interference approach, it was demonstrated that a cellular trans-Golgi network membrane protein, golgin-97, is essential for Vaccinia virus replication.
16262725 Selective and essential component of the tubulovesicular carriers transporting E-cadherin out of the trans-Golgi network.
15654769 The ability of the four mammalian GRIP domain proteins, p230, golgin-97, GCC88, and GCC185 to interact is reported.
15269279 Data show that Arl1 regulates the membrane recruitment of Golgin-97, which plays a role in transport from the endosome to the trans-Golgi network.

AA Sequence

MFAKLKKKIAEETAVAQRPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQIRKL      1 - 70
EARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQANRAKMAEGLALALARKDQEWSEKMD     71 - 140
QLEKEKNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQELSKIKHMLLKKEESLGKMEQELEARTRELS    141 - 210
RTQEELMNSNQMSSDLSQKLEELQRHYSTLEEQRDHVIASKTGAESKITALEQKEQELQALIQQLSIDLQ    211 - 280
KVTAETQEKEDVITHLQEKVASLEKRLEQNLSGEEHLQELLKEKTLAEQNLEDTRQQLLAARSSQAKAIN    281 - 350
TLETRVRELEQTLQASEEQLQQSKGIVAAQETQIQELAAANQESSHVQQQALALEQQFLERTQALEAQIV    351 - 420
ALERTRAADQTTAEQGMRQLEQENAALKECRNEYERSLQNHQFELKKLKEEWSQREIVSVAMAQALEEVR    421 - 490
KQREEFQQQAANLTAIIDEKEQNLREKTEVLLQKEQEILQLERGHNSALLQIHQLQAELEALRTLKAEEA    491 - 560
AVVAEQEDLLRLRGPLQAEALSVNESHVTSRAMQDPVFQLPTAGRTPNGEVGAMDLTQLQKEKQDLEQQL    561 - 630
LEKNKTIKQMQQRMLELRKTLQKELKIRPDNELFEVREKPGPEMANMAPSVTNNTDLTDAREINFEYLKH    631 - 700
VVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSKPAPKGSIRPSISNPRIPWS       701 - 767
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20610657 2010 FIP1/RCP binding to Golgin-97 regulates retrograde transport from recycling endosomes to the trans-Golgi network.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17724343 2007 Spatial regulation of Raf kinase signaling by RKTG.
17488291 2007 The trans-Golgi network golgin, GCC185, is required for endosome-to-Golgi transport and maintenance of Golgi structure.
17276477 2007 A host cell membrane protein, golgin-97, is essential for poxvirus morphogenesis.
More...