Property Summary

NCBI Gene PubMed Count 49
Grant Count 5
R01 Count 3
Funding $1,151,952.34
PubMed Score 15.17
PubTator Score 48.23

Knowledge Summary

Patent

No data available

Gene RIF (32)

PMID Text
26612539 RNA binding by TAF-15 is dependent upon structural elements in the RNA rather than sequence.
25496916 TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa (TAF15) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24474660 our data suggest that TAF15 and TLS/FUS operate within similar but not identical hnRNP M-TET protein complexes to influence the transcriptional or post-transcriptional output of a particular cell type.
24055347 Data indicate that distinct differences in proteins becoming Poly(ADP-ribose) PARylated upon various genotoxic insults are observed, exemplified by the PARylation of RNA-processing factors THRAP3 and TAF15 under oxidative stress.
23128393 TAF15 depletion inhibits growth & increases apoptosis. Its knockdown affects many genes involved in cell cycle & cell death. Among these, targets of microRNAs generated from the onco-miR-17 locus were overrepresented.
23049996 Data show that FUS and TAF15 locate to cellular stress granules to a larger extend than EWS. FET-protein stress granule association most likely is a downstream response to cellular stress.
22771914 TAF15 plays a role in RNA transport and/or local RNA translation
22065782 Missense mutations of TAF-15, an RNA-binding protein, were found in patients with amyotrophic lateral sclerosis, and gene conferred neurodegeneration when expressend in Drosophila.
22019700 The existence of a functionally discrete subset of U1 snRNP in association with TAF15 was suggested and provided further support for the involvement of U1 snRNP components in early steps of coordinated gene expression.
21856723 REsults suggest the possibility that alterations of TAF15 and EWS might also be involved in the pathogenesis of FUS proteinopathies such as ALS and FTLD.
More...

AA Sequence

MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGY      1 - 70
ENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHD     71 - 140
SYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFK    141 - 210
NFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTG    211 - 280
KPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRG    281 - 350
GDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG    351 - 420
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDR    421 - 490
GGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGG    491 - 560
DRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY                                          561 - 592
//

Text Mined References (61)

PMID Year Title
26612539 2015 Structural delineation of stem-loop RNA binding by human TAF15 protein.
24474660 2014 Selective interactions of hnRNP M isoforms with the TET proteins TAF15 and TLS/FUS.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24055347 2013 Proteome-wide identification of poly(ADP-Ribosyl)ation targets in different genotoxic stress responses.
23975937 2013 A conserved N-terminal motif is required for complex formation between FUS, EWSR1, TAF15 and their oncogenic fusion proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128393 2013 TAF15 is important for cellular proliferation and regulates the expression of a subset of cell cycle genes through miRNAs.
23049996 2012 Gene expression responses to FUS, EWS, and TAF15 reduction and stress granule sequestration analyses identifies FET-protein non-redundant functions.
22771914 2012 Domains involved in TAF15 subcellular localisation: dependence on cell type and ongoing transcription.
More...