Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
R01 Count 5
Funding $257,724.5
PubMed Score 1.00
PubTator Score 1.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92802 A3KME8
Symbols CG005
CG016
PFAAP5
92M18.3

Gene

Gene RIF (1)

PMID Text
19506020 Data suggest that expression of PFAAP5 allows neutrophil elastase to potentiate the repression of Gfi1 target genes.

AA Sequence

MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQE      1 - 70
NKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEARPPLVSADDEIYSTSKAFIGPIYKPPEKKKRNEGR     71 - 140
NEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIEELEKEKDGFENSCKESEPSQEQFVPFYEGH    141 - 210
NNGLLKPDEEKKDLSNKAMPSHCDYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGP    211 - 280
PLPSLNYHLNIQRFSGPPNPPSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPS    281 - 350
GNGCSMQDRYVSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSR    351 - 420
ILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNIQAWEMKPYVE    421 - 490
VAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMSISIVMNSVEPSHKSTQRPPP    491 - 560
PQGRQRWGGSLGSHNRVCVTNNH                                                   561 - 583
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
19506020 2009 Contributions to neutropenia from PFAAP5 (N4BP2L2), a novel protein mediating transcriptional repressor cooperation between Gfi1 and neutrophil elastase.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...