Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.39663116473355E-19
Breast cancer 3099 4.33512864827549E-13
ovarian cancer 8492 2.00508072324839E-9
Pick disease 1893 7.20890458571278E-8
malignant mesothelioma 3163 1.74093864589744E-7
juvenile dermatomyositis 1189 5.50366120058091E-7
osteosarcoma 7933 1.34697741057124E-6
psoriasis 6685 3.52783460469767E-6
cystic fibrosis and chronic rhinosinusitis 213 3.42212333529523E-4
oligodendroglioma 2849 6.87337221733723E-4
ependymoma 2514 0.00205543644317539
dermatomyositis 967 0.00330611043267912
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00484040394220942
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00552997652736048
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00569589229428819
astrocytic glioma 2241 0.0068587430981932
hereditary spastic paraplegia 313 0.0074929422782779
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.01099830401254
progressive supranuclear palsy 674 0.011863086774312
Waldenstrons macroglobulinemia 765 0.01676716483627
medulloblastoma, large-cell 6234 0.020252694202608
group 3 medulloblastoma 2254 0.027670711659899
esophageal adenocarcinoma 737 0.0291576802181821
Disease Target Count Z-score Confidence
Severe congenital neutropenia 10 3.409 1.7

Expression

Synonym

Accession Q92802 A3KME8
Symbols CG005
CG016
PFAAP5
92M18.3

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
19506020 Data suggest that expression of PFAAP5 allows neutrophil elastase to potentiate the repression of Gfi1 target genes.

AA Sequence

MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQE      1 - 70
NKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEARPPLVSADDEIYSTSKAFIGPIYKPPEKKKRNEGR     71 - 140
NEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIEELEKEKDGFENSCKESEPSQEQFVPFYEGH    141 - 210
NNGLLKPDEEKKDLSNKAMPSHCDYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGP    211 - 280
PLPSLNYHLNIQRFSGPPNPPSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPS    281 - 350
GNGCSMQDRYVSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSR    351 - 420
ILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNIQAWEMKPYVE    421 - 490
VAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMSISIVMNSVEPSHKSTQRPPP    491 - 560
PQGRQRWGGSLGSHNRVCVTNNH                                                   561 - 583
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
19506020 2009 Contributions to neutropenia from PFAAP5 (N4BP2L2), a novel protein mediating transcriptional repressor cooperation between Gfi1 and neutrophil elastase.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...