Property Summary

NCBI Gene PubMed Count 16
Grant Count 14
R01 Count 10
Funding $2,220,212.53
PubMed Score 10.22
PubTator Score 20.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -1.200 0.000
osteosarcoma -1.881 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell 1.300 0.001
non-small cell lung cancer -1.068 0.000
breast carcinoma -1.100 0.000
Breast cancer -2.600 0.037
pediatric high grade glioma -1.200 0.000
non primary Sjogren syndrome sicca -1.200 0.021
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -2.100 0.000
ovarian cancer -1.700 0.000

Gene RIF (3)

PMID Text
25578878 The related enzymatic subunits EZH1 and EZH2 undergo an expression switch during blood cell development.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19026781 EZH1 maintains repressive chromatin through different mechanisms.

AA Sequence

MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQS      1 - 70
MKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVK     71 - 140
EEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLP    141 - 210
VTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGP    211 - 280
NAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAML    281 - 350
HNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP    351 - 420
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTDELMNPS    421 - 490
QKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPG    491 - 560
CRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIK    561 - 630
ESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKV    631 - 700
VMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL                           701 - 747
//

Text Mined References (19)

PMID Year Title
25578878 2015 Developmental control of polycomb subunit composition by GATA factors mediates a switch to non-canonical functions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20075857 2010 JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.
19026781 2008 Ezh1 and Ezh2 maintain repressive chromatin through different mechanisms.
19026780 2008 EZH1 mediates methylation on histone H3 lysine 27 and complements EZH2 in maintaining stem cell identity and executing pluripotency.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...