Property Summary

NCBI Gene PubMed Count 57
PubMed Score 106.45
PubTator Score 132.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 5.0e-04
astrocytic glioma -1.200 2.4e-03
atypical teratoid / rhabdoid tumor -1.500 1.4e-05
ductal carcinoma in situ 1.300 1.4e-03
ependymoma -1.300 3.7e-03
glioblastoma -1.200 1.9e-08
group 4 medulloblastoma 1.900 3.3e-05
invasive ductal carcinoma 1.400 2.5e-03
lung cancer -1.200 1.3e-03
malignant mesothelioma -2.900 5.3e-08
osteosarcoma -1.573 1.0e-04
psoriasis -3.100 9.7e-06
subependymal giant cell astrocytoma -1.174 3.4e-02

Gene RIF (21)

AA Sequence

MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPR      1 - 70
TKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSDGMFKYEEIVLERGNSG     71 - 140
LGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVV    141 - 210
RLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLA    211 - 280
VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAV    281 - 350
ESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPA    351 - 420
DLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMS    421 - 490
SGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGV    491 - 560
IPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPV    561 - 630
IILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDN    631 - 700
LYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKA    701 - 770
MKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL                           771 - 817
//

Text Mined References (64)

PMID Year Title