Property Summary

NCBI Gene PubMed Count 55
Grant Count 53
R01 Count 27
Funding $6,591,938.51
PubMed Score 100.51
PubTator Score 132.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
astrocytic glioma -1.200 0.002
ependymoma -1.500 0.000
psoriasis -3.100 0.000
osteosarcoma -1.573 0.000
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
lung cancer -1.200 0.001
pediatric high grade glioma -1.400 0.000
group 4 medulloblastoma 1.900 0.000
subependymal giant cell astrocytoma -1.174 0.034
ductal carcinoma in situ 1.300 0.001
invasive ductal carcinoma 1.600 0.003

Gene RIF (18)

PMID Text
27222290 Insertion of a guanine into the DLG3 5' UTR, 7 bp upstream of the start codon, down regulated DLG3 protein levels. This non-coding variant segregates with X-linked intellectual disability in a large family.
25555912 These data shed new light on the role of SAP102 in the regulation of NMDAR trafficking.
25268382 Trans-homophilic interaction of CADM1 activates PI3K by forming a complex with MAGuK-family proteins MPP3 and Dlg.
24739954 miR-1246 might play a role in neurological pathogenesis of human enterovirus 71 by regulating DLG3 gene in infected cells.
24507884 This study identified DLG3 significantly associated loci with a biologically plausible role in schizophrenia.
24381070 The data of this study suggested that DLG3 is down-regulated in this cancer type.
23103165 The PDZ-independent interaction between SAP102 and GluN2B mediates the synaptic clearance of GluN2B-containing NMDARs.(SAP102 protein)
22745750 Synapse associated protein 102 (SAP102) binds the C-terminal part of the scaffolding protein neurobeachin.
21384559 A total of six novel and 11 known single nucleotide polymorphisms were identified. Further studies are warranted to analyze the candidate genes at Xq11.1-q21.33.
21369957 DLG3 did not associate with non-syndromic mental retardation in Chinese Han population; however, further studies are needed.
More...

AA Sequence

MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPR      1 - 70
TKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSDGMFKYEEIVLERGNSG     71 - 140
LGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVV    141 - 210
RLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLA    211 - 280
VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAV    281 - 350
ESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPA    351 - 420
DLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMS    421 - 490
SGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGV    491 - 560
IPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPV    561 - 630
IILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDN    631 - 700
LYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKA    701 - 770
MKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL                           771 - 817
//

Text Mined References (62)

PMID Year Title
27222290 2016 A non-coding variant in the 5' UTR of DLG3 attenuates protein translation to cause non-syndromic intellectual disability.
25780553 2015 The association of GPR85 with PSD-95-neuroligin complex and autism spectrum disorder: a molecular analysis.
25555912 2015 Subunit-specific regulation of N-methyl-D-aspartate (NMDA) receptor trafficking by SAP102 protein splice variants.
25268382 2014 Trans-homophilic interaction of CADM1 activates PI3K by forming a complex with MAGuK-family proteins MPP3 and Dlg.
24739954 2014 Parallel mRNA and microRNA profiling of HEV71-infected human neuroblastoma cells reveal the up-regulation of miR-1246 in association with DLG3 repression.
24507884 2014 Combined analysis of exon splicing and genome wide polymorphism data predict schizophrenia risk loci.
24381070 2014 Gene expression profiling analysis reveals that DLG3 is down-regulated in glioblastoma.
23103165 2012 SAP102 mediates synaptic clearance of NMDA receptors.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22745750 2012 Synapse associated protein 102 (SAP102) binds the C-terminal part of the scaffolding protein neurobeachin.
More...