Property Summary

NCBI Gene PubMed Count 48
PubMed Score 107.88
PubTator Score 62.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 0.8
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 104 4.835 2.4
Oropouche fever 2 4.443 2.2
Adult medulloblastoma 2 3.05 1.5

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer -1.200 1.0e-03
astrocytoma 1.400 5.3e-03
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
Breast cancer 2.900 4.8e-02
glioblastoma 1.300 2.0e-03
group 3 medulloblastoma 1.100 7.4e-03
malignant mesothelioma 1.200 2.3e-05
medulloblastoma, large-cell 1.700 7.3e-06
ovarian cancer -1.100 1.5e-06
pancreatic cancer 1.100 4.4e-02
primary pancreatic ductal adenocarcinoma 1.373 1.3e-02
psoriasis -1.300 5.4e-04
tuberculosis -1.100 1.2e-06

Protein-protein Interaction (2)

Gene RIF (34)

AA Sequence

MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTILKVSNKGLNS      1 - 70
YKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAA     71 - 140
SGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKESCESLSCLPPVSLLPHEKDKPVAEPIPICS    141 - 210
FCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLF    211 - 280
CDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKGRKLLQKKAAQIKRRYTNPIGRPKNRLKKQNTVSK    281 - 350
GPFSKVRTGPGRGRKRKITLSSQSASSSSEEGYLERIDGLDFCRDSNVSLKFNKKTKGLIDGLTKFFTPS    351 - 420
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEKDMELFRDIQE    421 - 490
QALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKC    491 - 560
GWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVG    561 - 630
YFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVIL    631 - 700
ECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVD    701 - 770
PECLRWTPVIVSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSHENKEQDSYSVESEKKPEVMAP    771 - 840
VSSTRLSKQVLPHDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYGECGEKSEATQ    841 - 910
EQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSERLPRRYSEGDRAV    911 - 980
LRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRRRRVRKRKHHNSSVVTETISETTEVLDEPFE    981 - 1050
DSDSERPMPRLEPTFEIDEEEEEEDENELFPREYFRRLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTP   1051 - 1120
ILKPVSLLRKRDVKNSPLEPDTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIE   1121 - 1190
PIVSIPKAGRKPKIQESEETVEPKEDMPLPEERKEEEEMQAEAEEAEEGEEEDAASSEVPAASPADSSNS   1191 - 1260
PETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDEDDGHLESTKKK   1261 - 1330
ELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSHDTSVVSEQMAGSEDDHEEDS   1331 - 1400
HTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHEGAYQDCEETLAACQTLQSYTQADEDPQMSM   1401 - 1470
VEDCHASEHNSPISSVQSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSD   1471 - 1540
HSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMA   1541 - 1610
SMGSSCSMMQQSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQ   1611 - 1680
QQPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSAT   1681 - 1750
FSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTT   1751 - 1820
MNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPSAVAMQAGPRA   1821 - 1890
LAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGS   1891 - 1960
QAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR                             1961 - 2004
//

Text Mined References (57)

PMID Year Title