Property Summary

NCBI Gene PubMed Count 469
Grant Count 397
R01 Count 255
Funding $28,706,372.43
PubMed Score 442.37
PubTator Score 1227.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.067 0.011
osteosarcoma -1.529 0.000
astrocytoma 1.700 0.002
subependymal giant cell astrocytoma -1.753 0.004
ovarian cancer -1.200 0.000

Synonym

Accession Q92793 D3DUC9 O00147 Q16376 Q4LE28
Symbols CBP
RSTS
KAT3A

Gene

PDB

1JSP   2N1A   2KWF   1RDT   2RNY   4N3W   4N4F   1LIQ   1WO3   1WO4   1WO5   1WO6   1WO7   1ZOQ   2D82   2KJE   2L84   2L85   2LXS   2LXT   3DWY   3P1C   3P1D   3P1E   3P1F   3SVH   4A9K   4NR4   4NR5   4NR6   4NR7   4NYV   4NYW   4NYX   4OUF   4TQN   4TS8   4WHU   4YK0   5CGP   5DBM   5I83   5I86   5I89   5I8B   5I8G   5JEM  

Gene RIF (248)

PMID Text
26870802 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling
26851278 Intrinsic protein disorder plays a prominent role in the function and interactions of the transcriptional co-activators CBP and p300. (Review)
26742101 Computational simulations were used to understand how phosphorylation affects the structure of the p53 terminal transactivation domain in complex with the CBP TAZ2 domain.
26628108 high expression of both CREB-binding protein and cleavage and polyadenylation specific factor 4 predicted a poor prognosis in the patients with lung adenocarcinomas.
26603346 Case Report: novel nonsense mutation of CREBBP in a patient with Rubinstein-Taybi syndrome.
26491150 Kaposi's sarcoma-associated herpesvirus vIRF4 targets the beta-catenin/CBP cofactor and blocks its occupancy on the cyclin D1 promoter, suppressing the G1-S cell cycle progression and enhancing virus replication.
26318425 RFPL3 and CBP have roles in upregulating hTERT activity and promoting lung cancer growth
26315281 Disruption of beta-catenin/CBP signaling inhibits human airway epithelial-mesenchymal transition and repair.
26164627 these findings suggest that sumoylation plays a critical role in the spatiotemporal co-activation of CLOCK-BMAL1 by CBP for immediate-early Per induction and the resetting of the circadian clock.
26021349 WNT/beta-catenin signaling does not affect nuclear translocation of the RelA subunit of NF-kappaB or its association with CBP (also known as CREBBP)
More...

AA Sequence

MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQL      1 - 70
SELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAAST     71 - 140
SGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMN    141 - 210
GSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPF    211 - 280
SQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEK    281 - 350
RKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK    351 - 420
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGL    421 - 490
PYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNP    491 - 560
LMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLV    561 - 630
AYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQP    631 - 700
VRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMP    701 - 770
QPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA    771 - 840
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSAT    841 - 910
QTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVAS    911 - 980
AETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE    981 - 1050
KKPEVKVEVKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLL   1051 - 1120
GIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEID   1121 - 1190
PVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT   1191 - 1260
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQ   1261 - 1330
TTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFE   1331 - 1400
EIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGH   1401 - 1470
IWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYF   1471 - 1540
EGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSM   1541 - 1610
PNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS   1611 - 1680
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLD   1681 - 1750
DEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCK   1751 - 1820
QLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPP   1821 - 1890
GTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAAR   1891 - 1960
QIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQ   1961 - 2030
PMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF   2031 - 2100
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQA   2101 - 2170
LNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGY   2171 - 2240
PPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQ   2241 - 2310
PNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQT   2311 - 2380
GSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL           2381 - 2442
//

Text Mined References (484)

PMID Year Title
26870802 2015 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling.
26851278 2016 Role of Intrinsic Protein Disorder in the Function and Interactions of the Transcriptional Coactivators CREB-binding Protein (CBP) and p300.
26742101 2016 Phosphorylation Regulates the Bound Structure of an Intrinsically Disordered Protein: The p53-TAZ2 Case.
26628108 2016 CREB-binding protein regulates lung cancer growth by targeting MAPK and CPSF4 signaling pathway.
26603346 2016 Identification of a novel de novo mutation of CREBBP in a patient with Rubinstein-Taybi syndrome by targeted next-generation sequencing: a case report.
26491150 2015 Kaposi's Sarcoma-Associated Herpesvirus Viral Interferon Regulatory Factor 4 (vIRF4) Perturbs the G1-S Cell Cycle Progression via Deregulation of the cyclin D1 Gene.
26318425 2015 RFPL3 and CBP synergistically upregulate hTERT activity and promote lung cancer growth.
26315281 2015 Disruption of ?-catenin/CBP signaling inhibits human airway epithelial-mesenchymal transition and repair.
26164627 2015 Sumoylation controls CLOCK-BMAL1-mediated clock resetting via CBP recruitment in nuclear transcriptional foci.
26021349 2015 WNT/?-catenin signaling inhibits CBP-mediated RelA acetylation and expression of proinflammatory NF-?B target genes.
More...