Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $260,084.2
PubMed Score 13.29
PubTator Score 7.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 0.000
atypical teratoid/rhabdoid tumor 1.600 0.000
non-small cell lung cancer 1.997 0.000
lung cancer 1.600 0.000
sonic hedgehog group medulloblastoma 1.300 0.001
pilocytic astrocytoma 1.100 0.000
ovarian cancer 2.600 0.000

Synonym

Accession Q92791 Q53GI6 Q9H4F6
Symbols NO55
SC65
NOL55
LEPREL4

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
23144993 SC65 protein is identified as an autoimmune target in idiopathic membranous nephropathy.

AA Sequence

MARVAWGLLWLLLGSAGAQYEKYSFRGFPPEDLMPLAAAYGHALEQYEGESWRESARYLEAALRLHRLLR      1 - 70
DSEAFCHANCSGPAPAAKPDPDGGRADEWACELRLFGRVLERAACLRRCKRTLPAFQVPYPPRQLLRDFQ     71 - 140
SRLPYQYLHYALFKANRLEKAVAAAYTFLQRNPKHELTAKYLNYYQGMLDVADESLTDLEAQPYEAVFLR    141 - 210
AVKLYNSGDFRSSTEDMERALSEYLAVFARCLAGCEGAHEQVDFKDFYPAIADLFAESLQCKVDCEANLT    211 - 280
PNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDF    281 - 350
QPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQE    351 - 420
PDAKGDEAEAEPEPELA                                                         421 - 437
//

Text Mined References (10)

PMID Year Title
23144993 2012 Identification and characterization of a new autoimmune protein in membranous nephropathy by immunoscreening of a renal cDNA library.
21269460 2011 Initial characterization of the human central proteome.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10952778 2000 Identification of nucleolar protein No55 as a tumour-associated autoantigen in patients with prostate cancer.
8862517 1996 cDNA cloning and characterization of a novel nucleolar protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.