Property Summary

NCBI Gene PubMed Count 98
Grant Count 123
R01 Count 90
Funding $16,940,758.83
PubMed Score 198.53
PubTator Score 180.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q92786 A6NK29 A8K2B1 Q5SW76 Q8TB91
Symbols

Gene

PDB

2LMD  

 GO Component (2)

 GWAS Trait (1)

Gene RIF (88)

PMID Text
26760117 PROX1 is an important regulator of endocrine secretory granule formation in medullary thyroid cancer cells.
26679606 These results suggest that the hepatic functions of the human iPS-HLCs could be enhanced by ATF5, c/EBPalpha, and PROX1 transduction.
26631740 Reduced expression of Prox1 is beneficial for the expansion and maturation of beta-cells.
26609053 Findings demonstrate that NOTCH-induced PROX1 inactivation significantly promotes the malignant behavior of thyroid carcinoma.
26310281 High PROX1 expression is associated with Esophageal Squamous Cell Carcinoma.
26063416 Our results indicate that immunohistochemical detection of PROX1 correlates with a more malignant phenotype in rectal neuroendocrine tumors
25735162 retina. These results confirm the conservative functions of Prox1/PROX1 in the vertebrate retina
25684142 Increase in PROX1 expression renders HCC cells more resistant to sorafenib treatment.
25573115 In primary lymphatic endothelial cells (HDLEC), miR-466 mimic transfection suppressed Prox1 mRNA and protein expression. HDLEC transfected with the miR-466 mimic suppressed tube formation as compared to the scrambled control.
25526434 PROX1 functions as a tumor suppressor gene in oral carcinogenesis.
More...

AA Sequence

MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQHADGEKSNVL      1 - 70
RKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTGSEVHQEDICSNSSRDSPPEC     71 - 140
LSPFGRPTMSQFDMDRLCDEHLRAKRARVENIIRGMSHSPSVALRGNENEREMAPQSVSPRESYRENKRK    141 - 210
QKLPQQQQQSFQQLVSARKEQKREERRQLKQQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMR    211 - 280
SEILDARAQDSVGRSDNEMCELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAE    281 - 350
TLKQELNTAMSQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNP    351 - 420
LDTFGNVQMASSTDQTEALPLVVRKNSSDQSASGPAAGGHHQPLHQSPLSATTGFTTSTFRHPFPLPLMA    421 - 490
YPFQSPLGAPSGSFSGKDRASPESLDLTRDTTSLRTKMSSHHLSHHPCSPAHPPSTAEGLSLSLIKSECG    491 - 560
DLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREF    561 - 630
YYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGK    631 - 700
DVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE                                     701 - 737
//

Text Mined References (104)

PMID Year Title
26760117 2016 PROX1 Promotes Secretory Granule Formation in Medullary Thyroid Cancer Cells.
26679606 2016 Hepatic maturation of human iPS cell-derived hepatocyte-like cells by ATF5, c/EBP?, and PROX1 transduction.
26631740 2016 Lack of Prox1 Downregulation Disrupts the Expansion and Maturation of Postnatal Murine ?-Cells.
26609053 2016 Aberrant Activation of Notch Signaling Inhibits PROX1 Activity to Enhance the Malignant Behavior of Thyroid Cancer Cells.
26310281 2015 Nuclear PROX1 is Associated with Hypoxia-Inducible Factor 1? Expression and Cancer Progression in Esophageal Squamous Cell Carcinoma.
26063416 2015 PROX1 is involved in progression of rectal neuroendocrine tumors, NETs.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25735162 [Intracellular localization of transcription factor PROX1 in the human retina in ontogeny].
25684142 2015 PROX1 promotes hepatocellular carcinoma proliferation and sorafenib resistance by enhancing ?-catenin expression and nuclear translocation.
25573115 2015 MicroRNA miR-466 inhibits Lymphangiogenesis by targeting prospero-related homeobox 1 in the alkali burn corneal injury model.
More...