Property Summary

NCBI Gene PubMed Count 110
PubMed Score 210.13
PubTator Score 180.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.400 3.2e-02
aldosterone-producing adenoma -1.128 4.5e-02
atypical teratoid / rhabdoid tumor -1.100 6.3e-03
colon cancer 1.600 2.6e-02
glioblastoma 1.400 4.7e-04
intraductal papillary-mucinous adenoma (... -1.300 2.3e-02
lung cancer 3.500 9.2e-06
lung carcinoma 4.700 7.2e-57
medulloblastoma 1.600 2.9e-02
medulloblastoma, large-cell 1.500 2.6e-02
pancreatic cancer -1.300 8.1e-03
Pick disease 1.100 2.1e-02
primitive neuroectodermal tumor 1.700 2.2e-02
subependymal giant cell astrocytoma -1.285 7.4e-03

 GO Component (2)

Gene RIF (100)

AA Sequence

MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQHADGEKSNVL      1 - 70
RKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTGSEVHQEDICSNSSRDSPPEC     71 - 140
LSPFGRPTMSQFDMDRLCDEHLRAKRARVENIIRGMSHSPSVALRGNENEREMAPQSVSPRESYRENKRK    141 - 210
QKLPQQQQQSFQQLVSARKEQKREERRQLKQQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMR    211 - 280
SEILDARAQDSVGRSDNEMCELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAE    281 - 350
TLKQELNTAMSQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNP    351 - 420
LDTFGNVQMASSTDQTEALPLVVRKNSSDQSASGPAAGGHHQPLHQSPLSATTGFTTSTFRHPFPLPLMA    421 - 490
YPFQSPLGAPSGSFSGKDRASPESLDLTRDTTSLRTKMSSHHLSHHPCSPAHPPSTAEGLSLSLIKSECG    491 - 560
DLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREF    561 - 630
YYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGK    631 - 700
DVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE                                     701 - 737
//

Text Mined References (116)

PMID Year Title