Property Summary

NCBI Gene PubMed Count 23
PubMed Score 50.95
PubTator Score 8.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Multiple myeloma 1332 5.8e-06
ovarian cancer 8520 1.1e-03
astrocytoma 1146 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hemopneumothorax 4 4.461 2.2
Coffin-Siris syndrome 17 3.614 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma 1.900 1.9e-03
Multiple myeloma 1.332 5.8e-06
ovarian cancer 1.700 1.1e-03

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQ      1 - 70
LYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDD     71 - 140
DSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYA    141 - 210
CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDS    211 - 280
KINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR    281 - 350
GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS                                 351 - 391
//

Text Mined References (36)

PMID Year Title