Tbio | Zinc finger protein ubi-d4 |
May be a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. Might also have a role in the development and maturation of lymphoid cells.
The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
Multiple myeloma | 1328 | 5.84734889196429E-6 |
ovarian cancer | 8492 | 0.0010537827232419 |
astrocytoma | 1493 | 0.00186540919277798 |
Disease | log2 FC | p |
---|---|---|
Multiple myeloma | 1.332 | 0.000 |
astrocytoma | 1.900 | 0.002 |
ovarian cancer | 1.700 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
26571505 | the role of SMARCA4 and the two SWI/SNF subunits SMARCD2/BAF60B and DPF2/BAF45D in leukaemia, was investigated. |
26417682 | DPF2 decreases monomeric and mono-ubiquitinated OCT4, assembles poly-ubiquitin chains on OCT4 mainly through Ub-K48 linkage |
21888896 | crystal structure of the C2H2-type zinc finger domain of human DPF2 with a canonical C2H2 fold, which contains two beta strands and one alpha helix, was reported. |
20571937 | found that targeting Requiem and Alg-2 did not result in extended culture viability, but resulted in an increase in maximum viable cell numbers and cumulative IVCD under fed-batch conditions |
20460684 | REQ functions as an efficient adaptor protein between the SWI/SNF complex and RelB/p52 and plays important roles in noncanonical NF-kappaB transcriptional activation and its associated oncogenic activity. |
MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQ 1 - 70 LYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDD 71 - 140 DSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYA 141 - 210 CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDS 211 - 280 KINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR 281 - 350 GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS 351 - 391 //
PMID | Year | Title |
---|---|---|
26571505 | 2015 | SWI/SNF Subunits SMARCA4, SMARCD2 and DPF2 Collaborate in MLL-Rearranged Leukaemia Maintenance. |
26417682 | 2015 | DPF2 regulates OCT4 protein level and nuclear distribution. |
25772364 | 2015 | SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage. |
25755297 | 2015 | System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
24927181 | 2014 | Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
21888896 | 2011 | Crystal structure of the Cys2His2-type zinc finger domain of human DPF2. |
More... |