Property Summary

NCBI Gene PubMed Count 21
PubMed Score 42.63
PubTator Score 8.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Multiple myeloma 1328 5.84734889196429E-6
ovarian cancer 8492 0.0010537827232419
astrocytoma 1493 0.00186540919277798

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.332 0.000
astrocytoma 1.900 0.002
ovarian cancer 1.700 0.001

Synonym

Accession Q92785 A8K7C9 B4DT58
Symbols REQ
UBID4
ubi-d4

Gene

PDB

3IUF  

  Ortholog (11)

Gene RIF (5)

PMID Text
26571505 the role of SMARCA4 and the two SWI/SNF subunits SMARCD2/BAF60B and DPF2/BAF45D in leukaemia, was investigated.
26417682 DPF2 decreases monomeric and mono-ubiquitinated OCT4, assembles poly-ubiquitin chains on OCT4 mainly through Ub-K48 linkage
21888896 crystal structure of the C2H2-type zinc finger domain of human DPF2 with a canonical C2H2 fold, which contains two beta strands and one alpha helix, was reported.
20571937 found that targeting Requiem and Alg-2 did not result in extended culture viability, but resulted in an increase in maximum viable cell numbers and cumulative IVCD under fed-batch conditions
20460684 REQ functions as an efficient adaptor protein between the SWI/SNF complex and RelB/p52 and plays important roles in noncanonical NF-kappaB transcriptional activation and its associated oncogenic activity.

AA Sequence

MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQ      1 - 70
LYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDD     71 - 140
DSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYA    141 - 210
CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDS    211 - 280
KINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR    281 - 350
GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS                                 351 - 391
//

Text Mined References (33)

PMID Year Title
26571505 2015 SWI/SNF Subunits SMARCA4, SMARCD2 and DPF2 Collaborate in MLL-Rearranged Leukaemia Maintenance.
26417682 2015 DPF2 regulates OCT4 protein level and nuclear distribution.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21888896 2011 Crystal structure of the Cys2His2-type zinc finger domain of human DPF2.
More...